DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or49a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523711.3 Gene:Or49a / 36350 FlyBaseID:FBgn0033727 Length:396 Species:Drosophila melanogaster


Alignment Length:365 Identity:75/365 - (20%)
Similarity:143/365 - (39%) Gaps:80/365 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RYLALIQKLTEAYYDLLNLNDSY-----ISEILDQVNKVG---KLMARGNLFFGMLTSMGFGLYP 138
            |||     |...|:.|..:::.|     .:.|::..:..|   |:|.:|..||.||:|....:..
  Fly    34 RYL-----LVRGYFVLCTISNFYEASMVTTRIIEWESLAGSPSKIMRQGLHFFYMLSSQLKFITF 93

  Fly   139 LSSSERVLPFGSKIPGL--------NEYE-SPYY------EMWYIFQMLITPM-------GCCMY 181
            :.:.:|:|....::..|        .:|| :.||      .:.|::..::..|       .|.||
  Fly    94 MINRKRLLQLSHRLKELYPHKEQNQRKYEVNKYYLSCSTRNVLYVYYFVMVVMALEPLVQSCIMY 158

  Fly   182 I------------------------------------PYTSLIVGLIMFGI---VRCKALQHRLR 207
            :                                    .|:..||. :..|.   :.|.:.|..:.
  Fly   159 LIGFGKADFTYKRIFPTRLTFDSEKPLGYVLAYVIDFTYSQFIVN-VSLGTDLWMMCVSSQISMH 222

  Fly   208 QVALKHPYGDRDPRELREE-----IIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALL 267
            ...|.:......|....|:     :.:.|:..|.:|.....:|.:..::....|...|.|||.:.
  Fly   223 LGYLANMLASIRPSPETEQQDCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMA 287

  Fly   268 FMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPLRKNILF 332
            :..::.....:.|...|....:.||...:..:...|.:.:..:|.||:|::|:...:..:|.||.
  Fly   288 YYTVVEGFNWEGISYMMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEGSLRYKKEILI 352

  Fly   333 MMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKR 372
            :|.:||||..|....:..|:|:.|:.|:..||.||.|:::
  Fly   353 LMAQAQRPLEISARGVIIISLDTFKILMTITYRFFAVIRQ 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 70/355 (20%)
Or49aNP_523711.3 7tm_6 88..384 CDD:251636 53/296 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466119
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.