DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or47b

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster


Alignment Length:366 Identity:77/366 - (21%)
Similarity:138/366 - (37%) Gaps:67/366 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SYMLVLWINTVLRAYLLLADHDRYLALIQK-------------------LTEAYYDLLNLNDSYI 105
            |..|..|||..:...::......::||.:.                   .|:.:|  ::|....|
  Fly    57 SLPLYRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFY--MHLRCDEI 119

  Fly   106 SEILDQVNKVGKLMARGNL---------------------------FFGMLTSMGFGLYPLSSSE 143
            .|::.......:.:...|:                           ||    |....|.|| ..|
  Fly   120 DELISDFEYYNRELRPHNIDEEVLGWQRLCYVIESGLYINCFCLVNFF----SAAIFLQPL-LGE 179

  Fly   144 RVLPFGSKIP-GLNEYESPYYEMW--YIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRCKALQHR 205
            ..|||.|..| ..:..:...|..|  ||:|.| |.....|.|    |:|.::........||..:
  Fly   180 GKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSL-TSQHNLMSI----LMVDMVGISTFLQTALNLK 239

  Fly   206 LRQVALKHPYGDRDPRELR--EEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALLF 268
            |..:.:: ..||.:..:.|  ||....:|:.|.||:.:...|......|..:|||..:|:....|
  Fly   240 LLCIEIR-KLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTF 303

  Fly   269 MLIIVSGTSQLIIVCMYINMILAQILALYWYANE--LREQNLAVATAAYE-TEWFTFDVPLRKNI 330
            ..:..:.....:.....:.|::|.|....|..:.  :..|::.||.||:: .:|.|....::::|
  Fly   304 ETMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDI 368

  Fly   331 LFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLK 371
            .|:::|||:|...:.....|.||..:..:|...|....:::
  Fly   369 SFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQ 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 76/357 (21%)
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 69/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.