DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or45b

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523667.1 Gene:Or45b / 35980 FlyBaseID:FBgn0033422 Length:396 Species:Drosophila melanogaster


Alignment Length:325 Identity:69/325 - (21%)
Similarity:139/325 - (42%) Gaps:57/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 RAYLLLADHDRYLALIQKLTEAYYDLLNLNDSYISEILDQVNKVGKLMARGNLFFGMLTSMGFGL 136
            |..||:.:.::.....:|:.:..|.|:             |.:.|.|:    ...|.:|:..|.|
  Fly   105 RIRLLIGEQEKREDSRRKVAQRSYYLM-------------VTRCGMLV----FTLGSITTGAFVL 152

  Fly   137 YPL--------SSSERVLPFGSKIPGLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIVGLIM 193
            ..|        ...:..:||....... .:..|::.::|::......:....:........|..:
  Fly   153 RSLWEMWVRRHQEFKFDMPFRMLFHDF-AHRMPWFPVFYLYSTWSGQVTVYAFAGTDGFFFGFTL 216

  Fly   194 FGIVRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMA 258
            :.....:||::.: |.||| |.  ||| .|||..|.|    |.:.:.:|..||:..:     :..
  Fly   217 YMAFLLQALRYDI-QDALK-PI--RDP-SLRESKICC----QRLADIVDRHNEIEKI-----VKE 267

  Fly   259 FSALLCALLFM------LIIVSGTSQLIIVCMYINMI--------LAQILALYWY-ANELREQNL 308
            ||.::.|..|:      |:|.:....:::...| |:|        ::..:.||.| ..|:..::|
  Fly   268 FSGIMAAPTFVHFVSASLVIATSVIDILLYSGY-NIIRYVVYTFTVSSAIFLYCYGGTEMSTESL 331

  Fly   309 AVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV 373
            ::..|||.:.|:|:|...|:.:..:::|||||..:.:....| :|.:|.:::..|.:...:.|.:
  Fly   332 SLGEAAYSSAWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI 395

  Fly   374  373
              Fly   396  395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 67/314 (21%)
Or45bNP_523667.1 7tm_6 68..386 CDD:251636 67/314 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.