DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or42b

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523624.2 Gene:Or42b / 35516 FlyBaseID:FBgn0033043 Length:399 Species:Drosophila melanogaster


Alignment Length:370 Identity:69/370 - (18%)
Similarity:139/370 - (37%) Gaps:69/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GIIRNSY-----MLVLWINTVLRAYLLLA------------DHDRYLALIQKLTEAYYDLLNLND 102
            |::|..|     |..:|..|    ||.|.            ....:|..:|....||...:.:..
  Fly    39 GVLRYVYLTWTLMTFVWCTT----YLPLGFLGSYMTQIKSFSPGEFLTSLQVCINAYGSSVKVAI 99

  Fly   103 SY--------ISEILDQVN----------KVGKLMARGNLFFGMLTSMGFGLYPLSSSERVLPFG 149
            :|        ...||||::          |:..::||.|..|.:.|.:..|....:....||   
  Fly   100 TYSMLWRLIKAKNILDQLDLRCTAMEEREKIHLVVARSNHAFLIFTFVYCGYAGSTYLSSVL--- 161

  Fly   150 SKIPGLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIV--------GLIMFGIVRC--KALQH 204
            |..|....| :|:.: |:...:.:.......|:..:..::        .||...|:|.  ..|:.
  Fly   162 SGRPPWQLY-NPFID-WHDGTLKLWVASTLEYMVMSGAVLQDQLSDSYPLIYTLILRAHLDMLRE 224

  Fly   205 RLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINEL------TTMMFLFELMAFSALL 263
            |:|::.......:   .|..||::.|:...:.|:.|...|..:      |..:.:..::.|:  |
  Fly   225 RIRRLRSDENLSE---AESYEELVKCVMDHKLILRYCAIIKPVIQGTIFTQFLLIGLVLGFT--L 284

  Fly   264 CALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWFTFDVPLRK 328
            ..:.|...|.:|.:..    |::..||.|.....:..|.:.|...::..|.:::.|.......:.
  Fly   285 INVFFFSDIWTGIASF----MFVITILLQTFPFCYTCNLIMEDCESLTHAIFQSNWVDASRRYKT 345

  Fly   329 NILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV 373
            .:|:.:...|:|...:.|.|..|::....::....::..|:.|::
  Fly   346 TLLYFLQNVQQPIVFIAGGIFQISMSSNISVAKFAFSVITITKQM 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 67/359 (19%)
Or42bNP_523624.2 7tm_6 76..381 CDD:251636 58/318 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.