DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or33c

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523555.1 Gene:Or33c / 34603 FlyBaseID:FBgn0026390 Length:384 Species:Drosophila melanogaster


Alignment Length:370 Identity:70/370 - (18%)
Similarity:143/370 - (38%) Gaps:68/370 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHDRYLALIQKLTEAYYDLLNLND 102
            |:...::.:.||.|    ..:|..|.:..:...|:       |..:|..:.::.| ...|:...|
  Fly    50 HLLLHLLLLPSTAE----FFKNLTMSLTCVACSLK-------HVAHLYHLPQIVE-IESLIEQLD 102

  Fly   103 SYISE------ILDQVNKVGKLMARG-NLFFGMLTSMG-FG------------LYPLSSSERVLP 147
            ::|:.      ..|.|:...:...|. .:.|||:.::. ||            |||     ...|
  Fly   103 TFIASEQEHRYYRDHVHCHARRFTRCLYISFGMIYALFLFGVFVQVISGNWELLYP-----AYFP 162

  Fly   148 FGSKIPGLNEYESPYYEMWYIFQMLI---TPMGCCMYIPYT-SLIVGLIMFGIVRCKALQHRLRQ 208
            |..:   .|.:.......:.:|.||:   ..:|...|.|.| .|:.|.:....:|...|.:...:
  Fly   163 FDLE---SNRFLGAVALGYQVFSMLVEGFQGLGNDTYTPLTLCLLAGHVHLWSIRMGQLGYFDDE 224

  Fly   209 VALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFELMAFSALLCALL-FMLII 272
            ..:.|           :.::..|...:.::.:.:.::...:.:.|.:|....|.||.:: :||..
  Fly   225 TVVNH-----------QRLLDYIEQHKLLVRFHNLVSRTISEVQLVQLGGCGATLCIIVSYMLFF 278

  Fly   273 VSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEWF------TFDVPLRKNIL 331
            |..|..|:...::..::..|:....::|:|:.|:...:..|.:.:.|:      .||:     ::
  Fly   279 VGDTISLVYYLVFFGVVCVQLFPSCYFASEVAEELERLPYAIFSSRWYDQSRDHRFDL-----LI 338

  Fly   332 FMMMR-AQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRVYG 375
            |..:. ..|...|..|.:..:.|..|...|...|:.|.|:.|..|
  Fly   339 FTQLTLGNRGWIIKAGGLIELNLNAFFATLKMAYSLFAVVVRAKG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 61/342 (18%)
Or33cNP_523555.1 7tm_6 60..372 CDD:251636 64/347 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.