DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or33a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523553.1 Gene:Or33a / 34601 FlyBaseID:FBgn0026392 Length:378 Species:Drosophila melanogaster


Alignment Length:389 Identity:79/389 - (20%)
Similarity:147/389 - (37%) Gaps:71/389 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FWALL---YDKNLRRYVCIGLASF-------HIF------TQIVYMMS---TNEGLTGIIRNSYM 62
            :|.||   .|...||.|...:.||       |:.      .||....|   |:|.|  .....:.
  Fly    19 YWRLLGVEGDYPFRRLVDFTITSFITILFPVHLILGMYKKPQIQVFRSLHFTSECL--FCSYKFF 81

  Fly    63 LVLW----INTVLRAYLLLADHDRYLALIQKLTEAYYDLLNLNDSYISEILDQVNKVGKLMARGN 123
            ...|    |.|:..   ||.|.|   :.::...|..|  .|.|.|.::.:|.:...|..:.|   
  Fly    82 CFRWKLKEIKTIEG---LLQDLD---SRVESEEERNY--FNQNPSRVARMLSKSYLVAAISA--- 135

  Fly   124 LFFGMLTSMGFGLYPLSSSERVLPFGSKIPGLNEYESPYYEMWYIFQ--------MLITPMGCCM 180
                ::|:...||:   |:.|.|.:....|  .::::.....|..|.        :::..:....
  Fly   136 ----IITATVAGLF---STGRNLMYLGWFP--YDFQATAAIYWISFSYQAIGSSLLILENLANDS 191

  Fly   181 YIPYTSLIV-GLIMFGIVRCKALQHRLR----QVALKHPYGDRDPRELREEIIACIRYQQSIIEY 240
            |.|.|..:| |.:...|:|...:.|.::    :...|...|.:|.|:|    :..||..:|.:  
  Fly   192 YPPITFCVVSGHVRLLIMRLSRIGHDVKLSSSENTRKLIEGIQDHRKL----MKIIRLLRSTL-- 250

  Fly   241 MDHINELTTMMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELRE 305
              |:::|.  .||...:..|..|..:||   .......::...::...:|.::....:|...:..
  Fly   251 --HLSQLG--QFLSSGINISITLINILF---FAENNFAMLYYAVFFAAMLIELFPSCYYGILMTM 308

  Fly   306 QNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTV 369
            :...:..|.:.:.|...|....::::.:|.....|..|..|.|..|.:..|...:...|:|:|:
  Fly   309 EFDKLPYAIFSSNWLKMDKRYNRSLIILMQLTLVPVNIKAGGIVGIDMSAFFATVRMAYSFYTL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 61/327 (19%)
Or33aNP_523553.1 7tm_6 61..367 CDD:251636 65/340 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.