DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or24a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster


Alignment Length:393 Identity:83/393 - (21%)
Similarity:152/393 - (38%) Gaps:75/393 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RRYVCIGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHDRYLALIQKLT 91
            :|.|.:.|.||..|..:.|.... |...||    :.:.:.|.|.|.|...:|  ...|:|::.:.
  Fly    34 KRTVLVKLWSFFNFFILTYGCYA-EAYYGI----HYIPINIATALDALCPVA--SSILSLVKMVA 91

  Fly    92 EAYY-DLLNLNDSYISEI--LDQVNKVGKLMARGNLFFGMLTSMGFGL----YPLSSSERV---- 145
            ..:| |.|.   |.|..:  |.:..|..:.:.....|:.:.|.:.|.|    :..|:|..|    
  Fly    92 IWWYQDELR---SLIERVRFLTEQQKSKRKLGYKKRFYTLATQLTFLLLCCGFCTSTSYSVRHLI 153

  Fly   146 ---------------LPFGSKIPGLNEYESPYYEMWYI---FQMLITP----------MGCCMYI 182
                           .||....|.| ....|.|.:.||   :...||.          :|.|:| 
  Fly   154 DNILRRTHGKDWIYETPFKMMFPDL-LLRLPLYPITYILVHWHGYITVVCFVGADGFFLGFCLY- 216

  Fly   183 PYTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINEL 247
             :|.|::           .||..:..: |:....::.|.|..|..|  :|..:.:::..:.:.||
  Fly   217 -FTVLLL-----------CLQDDVCDL-LEVENIEKSPSEAEEARI--VREMEKLVDRHNEVAEL 266

  Fly   248 TTMM-------FLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELRE 305
            |..:       .|...:..|.::...:..:::.||.. :|:..:|...:..:|.......:.:.|
  Fly   267 TERLSGVMVEITLAHFVTSSLIIGTSVVDILLFSGLG-IIVYVVYTCAVGVEIFLYCLGGSHIME 330

  Fly   306 QNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVL 370
            ....:|.:.:.:.|:...|.::|..|.|:.||||...|.:....| :||...::|..|.:...:.
  Fly   331 ACSNLARSTFSSHWYGHSVRVQKMTLLMVARAQRVLTIKIPFFSP-SLETLTSILRFTGSLIALA 394

  Fly   371 KRV 373
            |.|
  Fly   395 KSV 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 72/356 (20%)
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 70/343 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465284
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.