DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or22c

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_523454.2 Gene:Or22c / 33381 FlyBaseID:FBgn0026396 Length:402 Species:Drosophila melanogaster


Alignment Length:377 Identity:84/377 - (22%)
Similarity:155/377 - (41%) Gaps:73/377 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 YVCIGLASFHIFTQIVYMMSTNEGLTGIIRNSYMLVLWINTVLRAYLLLADHDRYLALIQKL--- 90
            |.|:     |:...:|.:.:...|.|..:           .||:.::....:.|:..|:|:|   
  Fly    62 YGCV-----HLDNLVVALEAFCPGTTKAV-----------CVLKLWVFFRSNRRWAELVQRLRAI 110

  Fly    91 ------TEAYYDLLNLNDSYISEILDQVNKVGKLMARGNLFFGMLTSMGFGLYPL---------- 139
                  .||...|:.|..:        .|::..|:    |..|..|:..|.|.||          
  Fly   111 LWESRRQEAQRMLVGLATT--------ANRLSLLL----LSSGTATNAAFTLQPLIMGLYRWIVQ 163

  Fly   140 SSSERVLPFGSKIPGLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIVGLIMFGIVRC----- 199
            ...:..|||...:|.. ..:...:.:.|:   |:|..|.|....: |.:.|   |.|..|     
  Fly   164 LPGQTELPFNIILPSF-AVQPGVFPLTYV---LLTASGACTVFAF-SFVDG---FFICSCLYICG 220

  Fly   200 --KALQHRLRQVALKHPYGD-------RDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFE 255
              :.:|..:|:: ....:||       ....|:|..:...:....:||::...:....|::.|..
  Fly   221 AFRLVQQDIRRI-FADLHGDSVDVFTEEMNAEVRHRLAQVVERHNAIIDFCTDLTRQFTVIVLMH 284

  Fly   256 LMAFSALLCA-LLFMLIIVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAYETEW 319
            .::.:.:||: :|.:::..|..|.|..:| ||...|.|:....:..|.:.|.:.|||...|:.||
  Fly   285 FLSAAFVLCSTILDIMLNTSSLSGLTYIC-YIIAALTQLFLYCFGGNHVSESSAAVADVLYDMEW 348

  Fly   320 FTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLK 371
            :..|...||.||.::.|:||...|.:....| :|...:::|:|..::.|:||
  Fly   349 YKCDARTRKVILMILRRSQRAKTIAVPFFTP-SLPALRSILSTAGSYITLLK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 76/344 (22%)
Or22cNP_523454.2 7tm_6 69..392 CDD:251636 78/356 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465275
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.