DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or10a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_511122.1 Gene:Or10a / 32086 FlyBaseID:FBgn0030298 Length:406 Species:Drosophila melanogaster


Alignment Length:266 Identity:55/266 - (20%)
Similarity:99/266 - (37%) Gaps:79/266 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 PFGSKIPG-LNEYESPYYEMWYIF-----QMLITPMGCC------------------------MY 181
            ||...:|. |..|  |::.:.|||     .:.|...|.|                        |:
  Fly   176 PFNMTMPKVLLNY--PFFPLTYIFIAYTGYVTIFMFGGCDGFYFEFCAHLSALFEVLQAEIESMF 238

  Fly   182 IPYTSLIVGLIMFGIVRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINE 246
            .|||.    .:....|:...|:.::|.|.::|           ..||...|:      :.|....
  Fly   239 RPYTD----HLELSPVQLYILEQKMRSVIIRH-----------NAIIDLTRF------FRDRYTI 282

  Fly   247 LTTMMFLFELM--AFSAL---------LCALLFMLIIVSGTSQLIIVCMYINMILAQILALYWYA 300
            :|...|:...|  .||.:         |.|:|::...|:..|||::.| |...::|         
  Fly   283 ITLAHFVSAAMVIGFSMVNLLTLGNNGLGAMLYVAYTVAALSQLLVYC-YGGTLVA--------- 337

  Fly   301 NELREQNLAVATAAYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYT 365
                |.:..:..|.:...|..|....|:.:..:::|:|||.::.:....| :|..|..:|.|:.:
  Fly   338 ----ESSTGLCRAMFSCPWQLFKPKQRRLVQLLILRSQRPVSMAVPFFSP-SLATFAAILQTSGS 397

  Fly   366 FFTVLK 371
            ...::|
  Fly   398 IIALVK 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 54/257 (21%)
Or10aNP_511122.1 7tm_6 70..396 CDD:251636 54/257 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465278
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.