DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or65c

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_729163.2 Gene:Or65c / 318013 FlyBaseID:FBgn0041623 Length:410 Species:Drosophila melanogaster


Alignment Length:259 Identity:57/259 - (22%)
Similarity:108/259 - (41%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 MLTSMGFGLYPLSSSERVLPFGSKIPGLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIVGL- 191
            ::||      ||...:::||..:..| ...:|...:.:.:.|..|........::.:...|.|| 
  Fly   168 LITS------PLWVHQQILPLHAAFP-FQWHEKSIHPISHAFIYLFQTWNVMYFLTWLVCIEGLS 225

  Fly   192 ------IMFGI-VRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTT 249
                  |.|.| |.|..|:| |.|..  |.|     .:||.|....:::.|.|:..:||.|::..
  Fly   226 VSIYVEITFAIEVLCLELRH-LHQRC--HGY-----EQLRLETNRLVQFHQKIVHILDHTNKVFH 282

  Fly   250 MMFLFELMAFSALLCALLFMLIIVSGTSQLIIVCMYINMILA-QILALYWYANELREQ-NLAVAT 312
            ...:.: |..:..|.:|..:..:.:.....::....:.|:|| ..|:::.|..:|..| :|.::.
  Fly   283 GTLIMQ-MGVNFFLVSLSVLEAMEARKDPKVVAQFAVLMLLALGHLSMWSYFGDLLSQKSLTISE 346

  Fly   313 AAYETEWFTFDVPLR------KNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVL 370
            ||||    .:| |::      :::..::.|.|.|..:............:..:||..|...|.|
  Fly   347 AAYE----AYD-PIKGSKDVYRDLCLIIRRGQEPLIMRASPFPSFNFINYSAILNQCYGILTFL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 54/251 (22%)
Or65cNP_729163.2 7tm_6 87..399 CDD:251636 54/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.