DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or49b and Or2a

DIOPT Version :9

Sequence 1:NP_523721.1 Gene:Or49b / 36413 FlyBaseID:FBgn0028963 Length:375 Species:Drosophila melanogaster
Sequence 2:NP_525046.1 Gene:Or2a / 31207 FlyBaseID:FBgn0023523 Length:397 Species:Drosophila melanogaster


Alignment Length:384 Identity:78/384 - (20%)
Similarity:164/384 - (42%) Gaps:76/384 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LTGIIR----NSYMLVLW------INTVLRAYLLLADHDRYL------ALIQKLTEAYYDLL-NL 100
            |||::|    :|.:.|::      :.|||....|||   |.|      .|.:.||....|:: ||
  Fly    24 LTGLMRPPGVSSLLYVVYSITVNLVVTVLFPLSLLA---RLLFTTNMAGLCENLTITITDIVANL 85

  Fly   101 NDSYISEILDQVNKVGKLM----ARGNLF--------FGMLTSMGFGLYPLSSSERVLPFGSKIP 153
            ..:.:..:..|::::..|:    ||..|.        .....::..|.:...:|  :..||:.:.
  Fly    86 KFANVYMVRKQLHEIRSLLRLMDARARLVGDPEEISALRKEVNIAQGTFRTFAS--IFVFGTTLS 148

  Fly   154 GLNEYESP----YYEMWY------------------IFQMLITPMGCC---MYIP-YTSLIVGLI 192
            .:.....|    .|..|:                  :|.:::..:..|   .|.| :..|:.|  
  Fly   149 CVRVVVRPDRELLYPAWFGVDWMHSTRNYVLINIYQLFGLIVQAIQNCASDSYPPAFLCLLTG-- 211

  Fly   193 MFGIVRCKALQHRLRQVALKHPYGDRDP------RELREEIIACIRYQQSIIEYMDHINELTTMM 251
                 ..:||:.|:|::..:....::..      .|:.:|:|.|||....:....:.|..:.::.
  Fly   212 -----HMRALELRVRRIGCRTEKSNKGQTYEAWREEVYQELIECIRDLARVHRLREIIQRVLSVP 271

  Fly   252 FLFELMAFSALLCALLFMLIIVSGT---SQLIIVCMYINMILAQILALYWYANELREQNLAVATA 313
            .:.:.:..:|:.|.:....:.|:..   :.:||..::.:.:..::..:.::.:.:|.|:.|:..|
  Fly   272 CMAQFVCSAAVQCTVAMHFLYVADDHDHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDA 336

  Fly   314 AYETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKR 372
            .|:..|.......::.:||.:.|.|||:.|..||...::||.|:.::..||:.||:|.|
  Fly   337 FYDCNWIEQLPKFKRELLFTLARTQRPSLIYAGNYIALSLETFEQVMRFTYSVFTLLLR 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or49bNP_523721.1 7tm_6 53..364 CDD:251636 72/374 (19%)
Or2aNP_525046.1 7tm_6 66..387 CDD:251636 58/329 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465772
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.