DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9h1 and cyp-25A6

DIOPT Version :9

Sequence 1:NP_610820.1 Gene:Cyp9h1 / 36412 FlyBaseID:FBgn0033775 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_001360017.1 Gene:cyp-25A6 / 187059 WormBaseID:WBGene00019438 Length:235 Species:Caenorhabditis elegans


Alignment Length:216 Identity:57/216 - (26%)
Similarity:100/216 - (46%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MIALALFIILLVLLYKWSVAKYDVFSERGVSHEKPWPLIGN----IPLKAMIGGMPVLKKMIELH 65
            :::|..|||.::|..|   .::.:..:.|:|..:|..|:||    |..||.:|.........:||
 Worm    10 LVSLVSFIIYVILARK---ERFRLRGKIGLSGPEPHWLMGNLKQIIERKAKLGYDDSYDWYNKLH 71

  Fly    66 TKHTGSPVYGIYALRDAVFFVRDPELIKLIGIKEFDHFVNHNS----MHNNIQESILSKSLISLR 126
             |..|. .:|||........:.:.|.||.:.||.|.:|.:...    ..|.::||:|..:.    
 Worm    72 -KQFGE-TFGIYFGTQLNINITNEEDIKEVFIKNFSNFSDRTPPPIIEDNKLKESLLQNTY---- 130

  Fly   127 DGRWKEMRNILTPAFTGSKMRIMYDLIQSCSEEGVIHIQEQLELSQDASIELEMKDYFTRFANDV 191
            :..||..|:.:.|.|:..||:.|::.|.|..:..:..::|:....|    :.::.|.|.....||
 Worm   131 ESGWKHTRSAIAPIFSTGKMKAMHETIHSKVDLFLEILKEKASSGQ----KWDIYDDFQGLTLDV 191

  Fly   192 IATVAFGISINSFRRKDNEFF 212
            |...||.|..|..|.:::.|:
 Worm   192 IGKCAFAIDSNCQRDRNDIFY 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9h1NP_610820.1 p450 38..512 CDD:278495 49/183 (27%)
cyp-25A6NP_001360017.1 p450 37..>215 CDD:386267 50/186 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166595
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 1 1.000 - - FOG0000037
OrthoInspector 1 1.000 - - mtm4722
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.