DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp9h1 and cest-32

DIOPT Version :9

Sequence 1:NP_610820.1 Gene:Cyp9h1 / 36412 FlyBaseID:FBgn0033775 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_504397.1 Gene:cest-32 / 178909 WormBaseID:WBGene00016862 Length:545 Species:Caenorhabditis elegans


Alignment Length:198 Identity:40/198 - (20%)
Similarity:64/198 - (32%) Gaps:69/198 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 FDHFVNHNSMHNNIQESIL----SKSLISLRDGRW--KEMRNILT--PAFTGSKMRIMYDLIQSC 156
            |.:|..|:.......||:|    |:.|...::...  |:....||  |.|.|......:|     
 Worm   254 FRNFAKHHGYEGEDSESLLEWYKSQPLSKFQETATFEKKASGFLTFIPNFDGDFFPKPFD----- 313

  Fly   157 SEEGVIHIQEQLELSQDASIELEMKDYFTRFANDVIATV----AFG-ISINSFRRKDNEFFRIGQ 216
                        |||::|.            ..|.:|||    ..| :::...||.|.:..:...
 Worm   314 ------------ELSREAP------------KLDAMATVDEYEGLGFLTMFQSRRNDMDIIKSSF 354

  Fly   217 AMSRI-SAWSVVKAMLYALFPRLMKVLRIQVLDTKNIDYFSSLVTAAMRYRQEHKVVRPDMIHLL 280
            ....: :|..|.|              ||.....||||            :.:.|.|...:|.|:
 Worm   355 GSDVVENAVDVQK--------------RIMEFYMKNID------------KNDDKAVEKRLIQLI 393

  Fly   281 MEA 283
            .::
 Worm   394 SDS 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp9h1NP_610820.1 p450 38..512 CDD:278495 40/198 (20%)
cest-32NP_504397.1 COesterase 15..516 CDD:278561 40/198 (20%)
Aes <104..>227 CDD:223730
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.