DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and FCN3

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:194 Identity:75/194 - (38%)
Similarity:100/194 - (51%) Gaps:19/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PHDCSEVHTQTDGL----HLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQ 595
            |.:|.|:.:|...|    ||..|.|:..|:.  |..|    ||...|||.|||.||.|||:.|..
Human    90 PRNCRELLSQGATLSGWYHLCLPEGRALPVF--CDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRA 152

  Fly   596 GFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYS-G 659
            |||....|||:|||.||.|||.....|:|:::|...|...|.|..|.:....|.|:|.:.::| |
Human   153 GFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEG 217

  Fly   660 NASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRY--------NLGLTW 715
            .|.|:|:...|..|:..|.|.|.|.::||....|.||::.|..:||||||        ..|:.|
Human   218 TAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDW 281

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 75/194 (39%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 75/194 (39%)