DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and FIBCD1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001138578.1 Gene:FIBCD1 / 84929 HGNCID:25922 Length:461 Species:Homo sapiens


Alignment Length:421 Identity:115/421 - (27%)
Similarity:171/421 - (40%) Gaps:91/421 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 ANANFNLSSQIASLDKLHTSMLELLEDVEGLQTKMDKSIPELRHEISKLEFANAQI----TSEQS 427
            |:||    |.:.::::..:|.|.:|         :|...|:|....::||.|.|.:    |..|:
Human    73 ASAN----SALVTVERADSSHLSIL---------IDPRCPDLTDSFARLESAQASVLQALTEHQA 124

  Fly   428 LIREEGTNAARSLQAMA-------VSVSVLQEEREGMRK----LSANVDQLRTNVDRLQSLVNDE 481
            ..|..|......|..:|       ...|.||.|..|:||    |...:..|::...||..|:: |
Human   125 QPRLVGDQEQELLDTLADQLPRLLARASELQTECMGLRKGHGTLGQGLSALQSEQGRLIQLLS-E 188

  Fly   482 MKNKLTH-----------------LNKPHKRPHHQNVQAQ--MPQDDSPIDSVLAETLVSELENV 527
            .:..:.|                 |.:|..:...|...|:  .|:.                   
Human   189 SQGHMAHLVNSVSDILDALQRDRGLGRPRNKADLQRAPARGTRPRG------------------- 234

  Fly   528 ETQYEAIINKLPHDCSEV---HTQTDGLHLIAPAGQRHPLMTHC----TADGWTTVQRRFDGSAD 585
                 ......|.||.:|   ..|.||::.:.|.........:|    ...|||..|||.|||.:
Human   235 -----CATGSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVN 294

  Fly   586 FNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKR-----FYISS 645
            |.|.|..|..|||...||.|:|.:::|.||......|.|.::|..:....|.|..     |.:..
Human   295 FFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFSVDP 359

  Fly   646 RADGYRLHIAEYSGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRYN 710
            ..|||.|.:|:|||.|.|:|....||:|:..|.|.|.|:.:|||.|.|.||:.:|..:||||:|.
Human   360 EEDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYL 424

  Fly   711 LGLTWFDAARNEW-------IAVKSSRMLVK 734
            .|.....|...||       .::|.|.|.::
Human   425 RGAHASYADGVEWSSWTGWQYSLKFSEMKIR 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 76/216 (35%)
FIBCD1NP_001138578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..238 4/47 (9%)
FReD 241..457 CDD:238040 76/215 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.