DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fgl2

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:433 Identity:110/433 - (25%)
Similarity:180/433 - (41%) Gaps:90/433 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 EQHRIANANFNLSSQIASLDKLHTSMLELLEDVEGLQTKMDKSIPELRHEISKLEFANAQITSEQ 426
            |:|.:.....:.|:|.|...:|..|     ...||.|.....::|.|..::.:      |..|.:
  Rat    21 EKHNLTEGLEDASAQAACPARLEGS-----GRCEGSQCPFQLTLPTLTLQLPQ------QFGSME 74

  Fly   427 SLIREEGT--NAARSLQAMAVSVSVLQEER-----EGMRKLSAN-VDQLRTNVDRLQSLVNDEMK 483
            .:::|..|  .|..||:.......:..:|.     .|......| |.:|.:.|::|.|    |:|
  Rat    75 EVLKEVRTLQEAVDSLKKSCQDCKLQADEHPDPGGNGAETAEDNRVQELESQVNKLSS----ELK 135

  Fly   484 N---------------KLTHLNKPHKRPHHQNVQAQMPQDDSPIDSVLAETLVSELENVETQYEA 533
            |               :|.::|         |::..:....:.:.||: .:|.|:.....:|...
  Rat   136 NAKEEIQGLQGRLESLQLVNMN---------NIENYVDNKVANLTSVV-NSLDSKCFKCPSQEHN 190

  Fly   534 IINKLPH----DCSEVHT---QTDGLHLIAPAGQRHPLMTHC----TADGWTTVQRRFDGSADFN 587
            ..|.:.|    |||:.:.   ::.|.:.:.|..:......:|    |..|||.:|.|.|||.:|.
  Rat   191 QPNPVQHLIYKDCSDYYVLGKRSSGTYRVTPDHRNSSFEVYCDMETTGGGWTVLQARLDGSTNFT 255

  Fly   588 RSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRL 652
            |.|.||..|||....|||:||:::|.||......|::.::|.......|.|.:||:::....|||
  Rat   256 RGWKDYKAGFGNLEREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVANEFLKYRL 320

  Fly   653 HIAEYSGNASDALNYQQGMQ-----FSAIDDDRD-ISQTHCAANYEGGWWFSHCQHANLNGRY-- 709
            |:..|:|.|.|||.:.:...     |:..|.|.| ....:|...|..||||..|..|||||:|  
  Rat   321 HLGNYNGTAGDALRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYH 385

  Fly   710 ------NLGLTWFDAARNEWIAV------------KSSRMLVK 734
                  ..|:.|     ..|..|            |.::|:::
  Rat   386 QRYKGVRNGIFW-----GTWPGVSQAHPGGYKFSFKKAKMMIR 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 71/234 (30%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 22/119 (18%)
Fibrinogen_C 199..425 CDD:278572 70/230 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.