DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and ANGPTL6

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:XP_011526650.1 Gene:ANGPTL6 / 83854 HGNCID:23140 Length:537 Species:Homo sapiens


Alignment Length:426 Identity:111/426 - (26%)
Similarity:185/426 - (43%) Gaps:60/426 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 LRFHHIDERVRSIEVEQHRIANANFNLSSQIASLDKLHTSMLELLEDVEGLQTKMDKSIPELRHE 411
            :|....:|.:|.::    |:|.|:..::.::.:|.|          :..||..::.:...:|:||
Human   134 MRVGRHEELLRELQ----RLAAADGAVAGEVRALRK----------ESRGLSARLGQLRAQLQHE 184

  Fly   412 ISKLEFANAQITSEQ----SLIREEGTNAARSLQAMAVSVSVLQEEREGMRKLSANVDQLRTNVD 472
            ........|.:.:|.    :|:.|...||:...|..|.....|..:   .|:|:..|.|..:.:.
Human   185 AGPGAGPGADLGAEPAAALALLGERVLNASAEAQRAAARFHQLDVK---FRELAQLVTQQSSLIA 246

  Fly   473 RLQSLVNDEMKNKLTHLNKPHKRPHHQNVQAQMPQDDSPIDSVLAETLVSELENVETQYEAIINK 537
            ||:.|.......:...|..|   |....|..::....|....:|......:.:..:.|.|.:.:.
Human   247 RLERLCPGGAGGQQQVLPPP---PLVPVVPVRLVGSTSDTSRMLDPAPEPQRDQTQRQQEPMASP 308

  Fly   538 LP--------------HDCSEV----HTQTDGLHLIAPAGQRHPLMTHC----TADGWTTVQRRF 580
            :|              .||:|.    |.|: |::.:...  ||.:...|    ...|||.:|||.
Human   309 MPAGHPAVPTKPVGPWQDCAEARQAGHEQS-GVYELRVG--RHVVSVWCEQQLEGGGWTVIQRRQ 370

  Fly   581 DGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISS 645
            |||.:|..:|..|..|||.|.||:|:|.|.::.||......|.|.::|.......|.|..|.:..
Human   371 DGSVNFFTTWQHYKAGFGRPDGEYWLGLEPVYQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEP 435

  Fly   646 RADGYRLHIAEYSGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNG--- 707
            .:|.|||.:.:|.|:|.|:|::.....||.:|.|||....:||....||||:..|.|:||||   
Human   436 ESDHYRLRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWH 500

  Fly   708 -------RYNLGLTWFDAARNEWIAVKSSRMLVKRL 736
                   ||..|:.|.: .|....:::.:.||::.|
Human   501 HGGHYRSRYQDGVYWAE-FRGGAYSLRKAAMLIRPL 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 73/229 (32%)
ANGPTL6XP_011526650.1 FReD 322..535 CDD:238040 72/216 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.