DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Angptl1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001102853.1 Gene:Angptl1 / 679942 RGDID:1598128 Length:300 Species:Rattus norvegicus


Alignment Length:188 Identity:38/188 - (20%)
Similarity:75/188 - (39%) Gaps:47/188 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LVDLQRTASNVAQDVQ-QRSSTFEDLATIRSDYQQLKLDLAAQRERQQQTEVYVQELREEMLQQE 273
            ||..|:....:..:.: |.:.|.:|:.| |.|.:.|| |:.::::|:           .::||..
  Rat    53 LVPEQKITGPICVNTKGQDAGTIKDMIT-RMDLENLK-DVLSRQKRE-----------IDVLQLV 104

  Fly   274 QDFQHALVKLQQRTRKDGSSASVEEESGSQEANQEQTGLETTADHKRRHCRFQSEQIHQLQLAQR 338
            .|....:|...:..||:           |:..|...|.|                   .:||...
  Rat   105 VDVDGNIVNEVKLLRKE-----------SRNMNSRVTQL-------------------YMQLLHE 139

  Fly   339 NLRRQVNGLRFHHIDERVRSIEVEQHRIANANFNLSSQIASLDKL---HTSMLELLED 393
            .:|::.|.|....::.::.::..|..::|.....|..:.|||..|   .:.|:.:||:
  Rat   140 IIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITVLEE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343 19/90 (21%)
FBG 538..736 CDD:214548
Angptl1NP_001102853.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.