DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and fcn3

DIOPT Version :10

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001011233.1 Gene:fcn3 / 496672 XenbaseID:XB-GENE-6054553 Length:321 Species:Xenopus tropicalis


Alignment Length:182 Identity:68/182 - (37%)
Similarity:90/182 - (49%) Gaps:23/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 TDGLHLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNE 609
            |||         ..|:...|..|    ||...|||.|||.||.|.|..|.||||:...|||:|||
 Frog   129 TDG---------NKPINVLCDMDTDGGGWIVFQRRVDGSVDFYRDWKSYKQGFGSQLSEFWLGNE 184

  Fly   610 QLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGN-ASDALNYQQGMQF 673
            .:|.||.....:|:..::|..:|...|.|.:|.:...:..|.|...|::|. |.|:|:..|...|
 Frog   185 NIHLLTSSGNFQLRFDLEDFDNNRTYATYSKFRLEGESQKYTLRYGEFTGGPAGDSLSIHQNRAF 249

  Fly   674 SAIDDDRDIS-QTHCAANYEGGWWFSHCQHANLNGRY--------NLGLTWF 716
            |..|.|.|.| .|:||..|.|.||:..|.:.|.||.|        |:|:||:
 Frog   250 STKDADNDKSDSTNCATKYSGAWWYHSCLNTNPNGPYLRGTISKKNIGMTWY 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK03918 134..>485 CDD:235175
FBG 538..736 CDD:214548 68/182 (37%)
fcn3NP_001011233.1 Collagen 57..99 CDD:460189
FReD 109..320 CDD:238040 68/182 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.