DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and angptl4

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001243132.1 Gene:angptl4 / 492647 ZFINID:ZDB-GENE-041111-222 Length:460 Species:Danio rerio


Alignment Length:446 Identity:124/446 - (27%)
Similarity:203/446 - (45%) Gaps:91/446 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 LQLAQRNLRRQVNGLRFHHIDE---RVRSIEVEQHRIANANFN----LSSQIASLDKLHTSMLEL 390
            |||.|        ||: .|:|:   :||.|.::. ::.|...:    |:.|:...::|..:..:.
Zfish    52 LQLGQ--------GLK-EHVDKTKGQVRDITIKM-KVFNVTVSELGKLTQQLQEDNELLKAKAQN 106

  Fly   391 LEDVEG--------LQTKMDKSIPELR--HE-ISKLEFANAQITSEQSLIREEGTNAARSLQAMA 444
            |||.|.        |:.|.|:.:.:.:  || ::|||      .....|::.||..||.|..:.|
Zfish   107 LEDSESLVLNVSTDLRQKTDELLKDRQKDHERMNKLE------EKVDGLMQGEGLEAANSNYSDA 165

  Fly   445 VSVS-VLQEEREGMRKLSANVDQLRTNVD----RLQSLVND-EMKNKLTHLNKPHKRPHHQNVQA 503
            ..:. :|:.:.:.:..|...:.|.:..:|    |:::|.|. .|||:...|.:..:   ..|:.|
Zfish   166 RIIQWMLEAQNKRIDDLVERIKQQQEKLDKQNIRIRTLQNQITMKNERLSLKRMEE---DVNLNA 227

  Fly   504 QMPQDDSPIDSVLAETLVSELENVETQYEAIINKLPHDCSEVHTQ---TDGLHLIAPAGQRHPLM 565
            ...|.|||:                        .|..||.|:..:   :.||:.|.|:..: |..
Zfish   228 STEQRDSPV------------------------ALASDCHELFLRGETSSGLYTIQPSDSQ-PFE 267

  Fly   566 THC---TADGWTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQ 627
            .:|   ...|||.:|||.|||.||::.|..|..|||...||||:|.|::|.::......|:||..
Zfish   268 VYCEMTPEGGWTVIQRRQDGSVDFDQLWQAYQNGFGNLNGEFWLGLEKIHSVSKGGNYILKVQFS 332

  Fly   628 DIYDNVWVAEYKRFYISSRADGYRLHIAEY-SGNASDALNYQ-QGMQFSAIDDDRD-ISQTHCAA 689
            |..|.:....| ||:::.:.:.|.|.|.|. :||...:|..: ..:.||..|.|.| .:..:||.
Zfish   333 DWRDEIQSISY-RFHLNGQENNYSLRILESPAGNTESSLPTETSAVPFSTRDKDNDQKNDLNCAK 396

  Fly   690 NYEGGWWFSHCQHANLNGRY------------NLGLTWFDAARNEWIAVKSSRMLV 733
            ...||||||:|..:||||||            ..|:.| ...|..:..:|::.|::
Zfish   397 QLSGGWWFSNCGRSNLNGRYFVTPAPKQRHQRKQGVFW-KTWRGRYYPLKTTTMMI 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 73/217 (34%)
angptl4NP_001243132.1 DUF4795 78..>224 CDD:292662 34/154 (22%)
FReD 240..453 CDD:238040 72/215 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.