DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and angptl7

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001006073.1 Gene:angptl7 / 450053 ZFINID:ZDB-GENE-041010-175 Length:338 Species:Danio rerio


Alignment Length:303 Identity:87/303 - (28%)
Similarity:129/303 - (42%) Gaps:78/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 VDQLRTNVDRLQSLVNDEMKNKLTHLNKPHKRPHHQNVQAQMPQDDSPIDSVLAETLVSELENVE 528
            |..|:..|..|.|:        |..|||               :.:|.:..|:.:.:  |||.:.
Zfish    41 VRSLKVQVANLSSM--------LEELNK---------------KQESELMKVVRQMM--ELEKLN 80

  Fly   529 TQYEAIINKLPHDCSEVHTQTDGLHLIAPAGQRHP------------------------------ 563
            .|.||.:.:.....||::.|.:.:.|  .|.|..|                              
Zfish    81 QQQEARVTEAESKYSEIYNQIEIMQL--QAAQSAPQQSTSDAIYDCASLYNKNYKISGEYKLPKD 143

  Fly   564 -------LMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLD 617
                   |...|..:    |||.:|||..|...|||.|..|..|||...|:||:|||.:..:|..
Zfish   144 DFLGTPELNVFCDMENNGGGWTLIQRRKIGLTSFNRDWKQYKNGFGTIRGDFWLGNEHIFRMTRQ 208

  Fly   618 NCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGNASDALNYQQGMQFSAIDDDRDI 682
            . :.|:::|:|...:|..|||..|.:|:..:.|:|.||.|||||.|:|.|.....||..:.|.|.
Zfish   209 P-TVLRIEMEDWEGDVRYAEYGFFTLSNEMNSYKLLIANYSGNAGDSLRYHNNTNFSTKNKDNDK 272

  Fly   683 SQTHCAANYEGGWWFSHCQHANLNG---RYNL------GLTWF 716
            ...:||...:||:|::.|..:||||   ||..      |::|:
Zfish   273 CLDNCAQLRQGGYWYNCCTDSNLNGVFYRYGSHTKNPDGISWY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 70/229 (31%)
angptl7NP_001006073.1 FReD 122..333 CDD:238040 63/195 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.