DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and CG30280

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster


Alignment Length:222 Identity:72/222 - (32%)
Similarity:113/222 - (50%) Gaps:15/222 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   500 NVQAQMPQDDSPIDSVLAETLVSELE---NVETQYEAIINKLPHDCSEVHTQTDGLHLIAPAGQR 561
            |::|...|.::.: |.|.|:|: :||   .:.|..:.|   .|..|.......:|||.:...| .
  Fly    30 NLEAIYEQAENAL-STLQESLL-QLETNGTLNTSPDVI---YPTSCLTSGDLENGLHTLKVPG-L 88

  Fly   562 HPLMTHC----TADGWTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRL 622
            .|...:|    ...||..:|:||.|:..|.|:|.:|..|||....|:::|.|::..||......|
  Fly    89 SPFQVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYKNGFGNLMDEYFLGLEKIRALTALEPHEL 153

  Fly   623 QVQMQDIYDNVWVAEYKRFYISSRADGYRLH-IAEYSGNASDALNYQQGMQFSAIDDDRDIS-QT 685
            .|.::|..|.:..|::..|.|.:..|.|.:: :.:|||.|.|:|...:.|:||..|.|.|.. ..
  Fly   154 YVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHRKMKFSTYDRDNDHEFNK 218

  Fly   686 HCAANYEGGWWFSHCQHANLNGRYNLG 712
            :||..|.||||::.|..:||||:|..|
  Fly   219 NCAFYYLGGWWYNACLDSNLNGQYMPG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 61/181 (34%)
CG30280NP_611641.6 FReD 65..279 CDD:238040 62/185 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.