DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and CG9500

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:289 Identity:72/289 - (24%)
Similarity:130/289 - (44%) Gaps:39/289 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   475 QSLVNDEMKNKLTHLNKPHKRPHHQNVQAQMPQDDSPIDSVLAETLVSELENVETQYEAIINKLP 539
            :::.::..:|.....|||..:..::.|.|.:.::.|...:...:...|:|...     .:..:.|
  Fly    19 EAMDSESFQNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTT-----GLSGRYP 78

  Fly   540 HDCSEVHTQTDGLHLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQGFGAP 600
            ..| ..:....|::.:...|.: |....|.|:    |||.:.||.....:|.||||:|..|||..
  Fly    79 SQC-PTYPPAHGIYTVQVLGLK-PFQVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYKNGFGQL 141

  Fly   601 GGEFWIGNEQLHHLTLDNCSRLQVQMQDI--------YDNVWVAEYKRFYISSRADGYRLHIAEY 657
            .|:|:||.::||.:|......|.:.::|.        ||.:::....:||..::       :.|:
  Fly   142 DGDFFIGLDKLHAITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTK-------LGEF 199

  Fly   658 SGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRYN----------LG 712
            :|:|.|::.:.:...||..|.|.|....:||..|.|.||..:|.::||.|.|.          .|
  Fly   200 TGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKG 264

  Fly   713 LTWFDAARNEWIAVKSSRMLVKRLPAVEC 741
            :.| .:.|.|..:.|..:|:|:  |...|
  Fly   265 IVW-HSWRTESYSYKVMQMMVR--PKCHC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 61/219 (28%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 61/222 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.