DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and CG1889

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster


Alignment Length:309 Identity:88/309 - (28%)
Similarity:131/309 - (42%) Gaps:51/309 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 SANVDQLRTNVDRLQSLVND---------EMKNKLTHLNKPHKRP-----HHQNVQAQMPQDDSP 511
            |..|..|.....|:|||.|:         .::.:|..|.:....|     ....:.::.|...:.
  Fly    41 SCPVSALSGLTTRMQSLNNEIASVKEQIGSLQEQLVDLRRAGSAPVVGLASPNALASRFPFSHNS 105

  Fly   512 IDSVLAETLVSELENVETQY-----EAIINKLPHDCSEVHTQTDGLHLIAPAGQRHPLMTHCTA- 570
            :|             :|.|.     .|.:...|.:|.:   |..|:..|.|.....|....|.. 
  Fly   106 LD-------------IEPQLLANGGAAAVPITPANCLK---QQHGVVRIRPRSNVEPFFVFCDQK 154

  Fly   571 ---DGWTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDN 632
               .|||.|..|:|||.||||.||||..|||....||:||.::||.:|..:...|.||:|:....
  Fly   155 VRNGGWTMVVNRYDGSEDFNRKWADYKIGFGPLTTEFFIGLDKLHQITSSDNYELLVQLQNRKQE 219

  Fly   633 VWVAEYKRFYISSRADGYRLHI-AEYSGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWW 696
            :..|.|..|.|.|.::.|||:: .:|.|:|:|||....|.:||..|...|.::.:|||...|.:|
  Fly   220 LRYALYDHFSIGSESEQYRLNVLGDYHGDAADALRDHTGKKFSTHDRVNDENEQNCAAQQSGAFW 284

  Fly   697 F-SHCQHANLNGRYN----------LGLTWFDAARNEWIAVKSSRMLVK 734
            : ..|...|..|.|.          .|:.|.........::|..||:|:
  Fly   285 YGGSCNLTNPFGLYQRLLERDVDGFKGILWRGFLNGPKGSLKIVRMMVR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 72/213 (34%)
CG1889NP_727376.2 Lzipper-MIP1 <34..80 CDD:291087 10/38 (26%)
FReD 123..335 CDD:238040 72/214 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.