DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and CG31832

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_723894.2 Gene:CG31832 / 318970 FlyBaseID:FBgn0051832 Length:227 Species:Drosophila melanogaster


Alignment Length:176 Identity:68/176 - (38%)
Similarity:97/176 - (55%) Gaps:9/176 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PHDCSEVHTQTDGLH-LIAPAGQRHPL-MTHC--TADGWTTVQRRFDGSADFNRSWADYAQGFGA 599
            ||.|..  ...:|:| |:.|  :..|. :|.|  ||..|..:|||.|||.:||:||..|..|||.
  Fly    22 PHTCPS--GSPNGIHQLMLP--EEEPFQVTQCKTTARDWIVIQRRLDGSVNFNQSWFSYKDGFGD 82

  Fly   600 PGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRL-HIAEYSGNASD 663
            |.|||:||.::|:.:|.:....|.:|::........|.:..|.:.|..:.|:| .:.:|||.|.|
  Fly    83 PNGEFFIGLQKLYLMTREQPHELFIQLKHGPGATVYAHFDDFQVDSETELYKLERVGKYSGTAGD 147

  Fly   664 ALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRY 709
            :|.|....:||..|.|.|.|..:|||.:.|||||..|..::|||.|
  Fly   148 SLRYHINKRFSTFDRDNDESSKNCAAEHGGGWWFHSCLSSSLNGLY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 68/176 (39%)
CG31832NP_723894.2 FReD 28..225 CDD:238040 65/168 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.