DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fibcd1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001101299.1 Gene:Fibcd1 / 311861 RGDID:1309097 Length:459 Species:Rattus norvegicus


Alignment Length:423 Identity:120/423 - (28%)
Similarity:181/423 - (42%) Gaps:93/423 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 ANANFNLSSQIASLDKLHTSMLELLEDVEGLQTKMDKSIPELRHEISKLEFANAQI----TSEQS 427
            |.||    |.:.::::..:|.|.||         :|...|:|....::||...|.|    :..|:
  Rat    73 AGAN----SALVTVERADSSHLSLL---------IDPRCPDLTDSFARLEGIQASILRTLSEHQA 124

  Fly   428 LIREEGTNAARSLQAMA-------VSVSVLQEEREGMRK----LSANVDQLRTNVDRLQSLVNDE 481
            ..|.:|  |...|.|:|       ...|.||.|..|:||    |...:..|::...||..|:: |
  Rat   125 QPRLDG--APELLDALADQLPRLLARASELQAECAGLRKGHSLLGQGLSTLQSEQGRLIQLLS-E 186

  Fly   482 MKNKLTHLNKPHKRPHHQNVQAQMPQDDSPIDSV--LAETLVSELENVETQYEAIINKL------ 538
            .:..:.||                      ::||  :.|.|..|......:.:|.:.:.      
  Rat   187 SQGHMAHL----------------------VNSVSDVLEALQRERGLGRPRVKADLQRAPSRGAR 229

  Fly   539 ---------PHDCSEV---HTQTDGLHLIAPAGQRHPLMTHC----TADGWTTVQRRFDGSADFN 587
                     |.||.:|   ..|.||::.:.|.........:|    ...|||..|||.|||.:|.
  Rat   230 PRGCANGSRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFF 294

  Fly   588 RSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKR-----FYISSRA 647
            |.|..|.:|||...||.|:|.:::|.||......|.|.::|..:....|.|..     |.:....
  Rat   295 RGWEAYREGFGKLTGEHWLGLKRIHALTTQAAYELHVDLEDFDNGTAYAHYGSFGVGLFSVDPEE 359

  Fly   648 DGYRLHIAEYSGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRYNLG 712
            |||.|.:|:|||.|.|:|....||:|:..|.|.|.|:.:|||.|.|.||:.:|..:||||:|..|
  Rat   360 DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRG 424

  Fly   713 --LTWFDAARNEW-------IAVKSSRMLVKRL 736
              .::.|..  ||       .::|.|.|.::.|
  Rat   425 PHASYADGV--EWSSWTGWQYSLKFSEMKIRPL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 76/233 (33%)
Fibcd1NP_001101299.1 FReD 239..455 CDD:238040 76/217 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.