DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and ANGPTL5

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_835228.2 Gene:ANGPTL5 / 253935 HGNCID:19705 Length:388 Species:Homo sapiens


Alignment Length:425 Identity:109/425 - (25%)
Similarity:173/425 - (40%) Gaps:105/425 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 LSSQIASLDKLHTSMLELLEDVEG--LQTKMDKSIPELRHEISKLE---FANAQITSEQ------ 426
            :|...|||..|:..:....|.|:|  :....|.|:..:..:.|..:   .:|..:..|.      
Human     2 MSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCD 66

  Fly   427 ---SLIREEGTNAARSLQAMAVSVSVLQEEREGMRKLSAN-VDQLRTNVDRLQSLVNDEMKNKLT 487
               .:.|||.....|:||...||.:      ...:||..| :|:.:.::|.|.:.||:.|...| 
Human    67 VKTKITREEKHFMCRNLQNSIVSYT------RSTKKLLRNMMDEQQASLDYLSNQVNELMNRVL- 124

  Fly   488 HLNKPHKRPHHQNVQAQMPQDDSPIDSVLAETLVSELENVETQYEAIINKLPH--------DCSE 544
                                           .|.:|:      :...::..||        ||::
Human   125 -------------------------------LLTTEV------FRKQLDPFPHRPVQSHGLDCTD 152

  Fly   545 VH------TQT-DGLHLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQGFG 598
            :.      |:| .||::|.|.|..:|....|..|    |.|.:|:|.||..||.|.|.||..|||
Human   153 IKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFG 217

  Fly   599 APGGEFWIGNEQLHHL-TLDNCS-RLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGNA 661
            ...||||:|.:::.:: ...|.| .|.|.::...|.:..|.|..|::......:::|:..|||||
Human   218 DLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNA 282

  Fly   662 SDAL------NYQQGMQFSAIDDDRDISQTHCAANYEG-----------GWWFSHCQHANLNGRY 709
            .||.      :.|..|.||..|.|.|..:..|..|.:.           ||||:.|..|||||.:
Human   283 GDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIH 347

  Fly   710 NL-------GLTWFDAARNEW-IAVKSSRMLVKRL 736
            :.       |:.|....:|.. :.:||..|.::|:
Human   348 HFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 75/243 (31%)
ANGPTL5NP_835228.2 FReD 146..382 CDD:238040 73/235 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.