DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fgl1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_742007.2 Gene:Fgl1 / 246186 RGDID:620169 Length:314 Species:Rattus norvegicus


Alignment Length:317 Identity:96/317 - (30%)
Similarity:139/317 - (43%) Gaps:72/317 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 LQEEREGMRKLSANVDQLRTNVDRLQSLVNDEMKNKLTHLNKPHKRPHHQNVQ-AQMPQDDSPID 513
            |||:    .:|.|.|.||.|.|.:.|.::...:              |.:.|| ....|:||.||
  Rat    29 LQEQ----VRLRAQVRQLETRVKQQQVVIAQLL--------------HEKEVQFLDRGQEDSFID 75

  Fly   514 SVLAETLVSELENVETQYEAIINKLPH--DCSEVHT---QTDGLHLIAPAGQRHPLMTHC---TA 570
                                 :....|  ||||::.   :..|.:.|.|.........:|   ..
  Rat    76 ---------------------LGGKRHYADCSEIYNDGFKHSGFYKIKPLQSLAEFSVYCDMSDG 119

  Fly   571 DGWTTVQRRFDGSADFNRSWADYAQGFG---APGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDN 632
            .|||.:|||.|||.:|||.|.||..|||   ...||:|:||:.::.||:.....|::.:.|...|
  Rat   120 GGWTVIQRRSDGSENFNRGWNDYENGFGNFVQSNGEYWLGNKNINLLTMQGDYTLKIDLTDFEKN 184

  Fly   633 VWVAEYKRFYISSRADGYRLHIAEYSGNASDALN-----------YQQGMQFSAIDDDRDISQTH 686
            ...|:|::|.:......|.|:|.||||.|.|:|:           ..|.|:||..|.|.|....:
  Rat   185 SRFAQYEKFKVGDEKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQTMKFSTRDRDNDNYNGN 249

  Fly   687 CAANYEGGWWFSHCQHANLNGRY---------NLGLTWFDAARNEWIAVKSSRMLVK 734
            ||...:.||||:.|..|||||.|         :.|:.|: ..|..|.::||..|.::
  Rat   250 CAEEEQSGWWFNRCHSANLNGVYYQGPYRAETDNGVVWY-TWRGWWYSLKSVVMKIR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 77/228 (34%)
Fgl1NP_742007.2 FReD 80..306 CDD:238040 77/227 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.