DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fgg

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:XP_006232587.1 Gene:Fgg / 24367 RGDID:2613 Length:445 Species:Rattus norvegicus


Alignment Length:417 Identity:101/417 - (24%)
Similarity:168/417 - (40%) Gaps:99/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 QTKMDKSIPELRHEISKLEFANAQITSEQSLIREEGTNAARSLQAMAVSVSVLQEEREGM----- 457
            ||.:|..:..|.:.:.:.|              ...|.|...::|:.|..:..|..:.||     
  Rat    59 QTDVDTDLQTLENILQRAE--------------NRTTEAKELIKAIQVYYNPDQPPKPGMIEGAT 109

  Fly   458 RKLSANVDQL----------RTNVDRLQSLVNDEMKNKLTHLNKPHKRPHHQNVQAQMPQDDSPI 512
            :|....|:::          .:::..||.:.... |.|:|:|.   ::......|.|.|..||  
  Rat   110 QKSKKMVEEILKYEALLLTHESSIRYLQDIYTSN-KQKITNLK---QKVAQLEAQCQEPCKDS-- 168

  Fly   513 DSVLAETLVSELENVETQYEAIINKLPHDCSEV---HTQTDGLHLIAPAGQRHPLMTHCTAD--- 571
                               ..|.:....||.::   ..:..||:.|.|.......:.:|..|   
  Rat   169 -------------------VRIHDTTGKDCQDIANKGAKESGLYFIRPLKATQQFLVYCEIDGSG 214

  Fly   572 -GWTTVQRRFDGSADFNRSWADYAQGFG--APGG--EFWIGNEQLHHLTLDNC--SRLQVQMQDI 629
             |||.:|:|.|||.||.::|..|.:|||  :|.|  |||:|||::|.:::.:.  ..|::|::|.
  Rat   215 NGWTVLQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDW 279

  Fly   630 YDNVWVAEYKRFYISSRADGYRLHIAEY-SGNASDALN--------------YQQGMQFSAIDDD 679
            ......|:|..|.:...:|.|||..|.: .|:|.||.:              ...||.||..|:|
  Rat   280 SGRTSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMHFSTWDND 344

  Fly   680 RDISQTHCAANYEGGWWFSHCQHANLNGRYNLGLTWFDAA--------------RNEWIAVKSSR 730
            .|..:.:||.....|||.:.|...:|||.|..|.|:..::              :..|.::|.:.
  Rat   345 NDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKSSTPNGYDNGIIWATWKTRWYSMKETT 409

  Fly   731 MLV---KRLPAVECQANASASGAFVSV 754
            |.:   .||...:.|.:.......|||
  Rat   410 MKIIPFNRLSIGDGQQHHMGGSKQVSV 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 69/242 (29%)
FggXP_006232587.1 Fib_alpha 31..172 CDD:400857 25/151 (17%)
Fibrinogen_C 175..414 CDD:395095 69/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.