DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fgl1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_663569.2 Gene:Fgl1 / 234199 MGIID:102795 Length:314 Species:Mus musculus


Alignment Length:332 Identity:100/332 - (30%)
Similarity:148/332 - (44%) Gaps:72/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 LQAMAVSVS----VLQEE---REGMRKLSANVDQLRTNVDRLQSLVNDEMKNKLTHLNKPHKRPH 497
            |.|:|:.:.    .|:.|   ||.:| |.|.|.||.|.|.:.|:::...:              |
Mouse     9 LVAIALMMGREGWALESENCLREQVR-LRAQVHQLETRVKQQQTMIAQLL--------------H 58

  Fly   498 HQNVQ-AQMPQDDSPIDSVLAETLVSELENVETQYEAIINKLPHDCSEVHT---QTDGLHLIAPA 558
            .:.|| .....::|.||.           ..:.||.        ||||::.   :..|.:.|.|.
Mouse    59 EKEVQFLDKGSENSFIDL-----------GGKKQYA--------DCSEIYNDGFKQSGFYKIKPL 104

  Fly   559 GQRHPLMTHC---TADGWTTVQRRFDGSADFNRSWADYAQGFG---APGGEFWIGNEQLHHLTLD 617
            ........:|   ...|||.:|||.|||.:|||.|.||..|||   ...||:|:||:.::.||:.
Mouse   105 QSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQ 169

  Fly   618 NCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGNASDALN-----------YQQGM 671
            ....|::.:.|...|...|:|:.|.:..:...|.|:|.||||.|.|:|:           ..|.|
Mouse   170 GDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRM 234

  Fly   672 QFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRY---------NLGLTWFDAARNEWIAVK 727
            :||..|.|.|..|.:||...:.||||:.|..|||||.|         :.|:.|: .....|.::|
Mouse   235 KFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWY-TWHGWWYSLK 298

  Fly   728 SSRMLVK 734
            |..|.::
Mouse   299 SVVMKIR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 76/226 (34%)
Fgl1NP_663569.2 FReD 80..306 CDD:238040 78/235 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.