DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and FGG

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_068656.2 Gene:FGG / 2266 HGNCID:3694 Length:453 Species:Homo sapiens


Alignment Length:427 Identity:109/427 - (25%)
Similarity:175/427 - (40%) Gaps:98/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 QTKMDKSIPELRHEISKLEFANAQITSEQSLIR--EEGTNAARSLQAMAVSVSVLQEER--EGMR 458
            |||:||.:..|...:.::|...:::   :.||:  :...|...|.:...:..:.|:..:  |.:.
Human    59 QTKVDKDLQSLEDILHQVENKTSEV---KQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIM 120

  Fly   459 KLSANVDQLRTNVDRLQSLVND------EMKNKLTHLNKPHKRPHHQNVQAQMPQDDSPIDSVLA 517
            |..|::....:::..||.:.|.      .:|.|:..|          ..|.|.|..|:       
Human   121 KYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQL----------EAQCQEPCKDT------- 168

  Fly   518 ETLVSELENVETQYEAIINKLPHDCSEV---HTQTDGLHLIAPAGQRHPLMTHCTAD----GWTT 575
                       .|...|..|   ||.::   ..:..||:.|.|.......:.:|..|    |||.
Human   169 -----------VQIHDITGK---DCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTV 219

  Fly   576 VQRRFDGSADFNRSWADYAQGFG--APGG--EFWIGNEQLHHLTLDNC--SRLQVQMQDIYDNVW 634
            .|:|.|||.||.::|..|.:|||  :|.|  |||:|||::|.::..:.  ..|:|:::|......
Human   220 FQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTS 284

  Fly   635 VAEYKRFYISSRADGYRLHIAEYS-GNASDALN--------------YQQGMQFSAIDDDRDISQ 684
            .|:|..|.:...||.|||..|.:: |:|.||.:              ...|||||..|:|.|..:
Human   285 TADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFE 349

  Fly   685 THCAANYEGGWWFSHCQHANLNGRYNLGLTWFDAA--------------RNEWIAVKSSRMLV-- 733
            .:||.....|||.:.|...:|||.|..|.|:..|:              :..|.::|.:.|.:  
Human   350 GNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIP 414

  Fly   734 -KRLPAVECQANASASGAFVSVSGSAADAAPSSGATT 769
             .||...|.|.:.         .|.|....|...|.|
Human   415 FNRLTIGEGQQHH---------LGGAKQVRPEHPAET 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 72/242 (30%)
FGGNP_068656.2 Fib_alpha 31..172 CDD:285864 26/143 (18%)
FReD 175..414 CDD:294064 73/241 (30%)
Gamma-chain polymerization, binding amino end of another fibrin alpha chain 400..422 5/21 (24%)
Platelet aggregation and Staphylococcus clumping 423..437 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..453 6/28 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.