DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and FCN1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001994.2 Gene:FCN1 / 2219 HGNCID:3623 Length:326 Species:Homo sapiens


Alignment Length:216 Identity:80/216 - (37%)
Similarity:113/216 - (52%) Gaps:20/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PHDCSEVHTQ---TDGLHLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQG 596
            |.:|.::..:   ..|.|.|.....| ||...|..|    |||..|||.|||.||.|.||.|.||
Human   115 PRNCKDLLDRGYFLSGWHTIYLPDCR-PLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQG 178

  Fly   597 FGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEY-SGN 660
            ||:..||||:||:.:|.||....|.|:|.:.|...|...|:||.|.::..|:.|:|.:..: .|:
Human   179 FGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGS 243

  Fly   661 ASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRYNL--------GLTWFD 717
            |.::|.......||..|.|.|:|.::||..::|.||::.|..:||||.|.:        |:.| .
Human   244 AGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINW-S 307

  Fly   718 AARNEWIAVKSSRMLVKRLPA 738
            ||:....:.|.|.|.|:  ||
Human   308 AAKGYKYSYKVSEMKVR--PA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 78/212 (37%)
FCN1NP_001994.2 Collagen 51..107 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..111
FReD 115..325 CDD:238040 78/213 (37%)
A domain, contributes to trimerization 115..154 10/39 (26%)
B domain, contributes to trimerization 155..243 39/87 (45%)
Carbohydrate-binding. /evidence=ECO:0000269|PubMed:17897951 282..284 0/1 (0%)
P domain. /evidence=ECO:0000303|PubMed:17148457 317..326 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.