DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and T15B7.1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_504743.3 Gene:T15B7.1 / 188512 WormBaseID:WBGene00020516 Length:372 Species:Caenorhabditis elegans


Alignment Length:193 Identity:62/193 - (32%)
Similarity:83/193 - (43%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 GWTTVQRRFDGSADF-NRSWADYAQGFG--APGGEFWIGNEQLHHLTLDNCSRLQVQMQ-DIYDN 632
            ||...|.|||.|..: :|.|.:|..|||  .....||:|||.||.:|.:....|:|:|. |...|
 Worm   181 GWVLFQNRFDDSESYWDRKWDEYKNGFGDVDENSNFWLGNEALHVMTTNKKVTLRVEMYGDRTPN 245

  Fly   633 ------VWVAEYKRFYISSRADGYRL-----HIAEYSGNASDA---LNYQQGMQFSAIDDDRDIS 683
                  .|...|..|.:.|:...|.|     ..|...||||.|   |....|..||.||:..| .
 Worm   246 SKNATDFWFGHYFDFQVGSKTQNYPLLDLTMDWANPIGNASTAWYDLTCSIGSPFSTIDNIHD-P 309

  Fly   684 QTHCAANYE-GGWWFSHCQHANLNGRY-------NLGLTWFDAARNEWIAVKSSRMLVKRLPA 738
            ...|...:: ||||..:|..:.|||.|       ..|:.|.....:..:..|.:|||::...|
 Worm   310 VKECVTKFQMGGWWLKNCALSTLNGAYTPKDWNNGYGMFWIWDGSDTILHPKKTRMLLRNTVA 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 61/189 (32%)
T15B7.1NP_504743.3 CLECT 21..138 CDD:214480
FReD 144..368 CDD:294064 61/187 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14151
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.