DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Y43C5A.2

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_501883.1 Gene:Y43C5A.2 / 177911 WormBaseID:WBGene00012782 Length:452 Species:Caenorhabditis elegans


Alignment Length:337 Identity:81/337 - (24%)
Similarity:126/337 - (37%) Gaps:99/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 LSANVDQLRTNVDRLQSL-----VNDEMKNKLTHLN---------KPHK---------------- 494
            |.|.|.....||....:|     :|.:|:|::::||         ..|.                
 Worm    57 LQAAVSATGQNVSSSNTLTSTNPINTQMENRISNLNLVVLDANAGNAHSFNGFDLHILISSDQAA 121

  Fly   495 ------------RPHHQNVQAQMPQDDSPIDSVL-----------AETLVSELENVETQY----- 531
                        ......|.:...|.||.:.:.:           :.|...|....|..:     
 Worm   122 NSIIDDYVIHVDTTQSTGVYSYTHQRDSTLSTTISIAWSTNISPPSTTSTPEPTTTEVPFTGSTL 186

  Fly   532 -EAIINKLPHDCSEVHTQT-DGLHLIAPAGQRHPLMTHC--TADG-WTTVQRR--FDGSADFNRS 589
             .....|.|.||||:...| .|:..|.|.|.  |:..:|  |:.| :|.:|.|  ...:.:||.:
 Worm   187 PPTTTPKPPMDCSEISNLTSSGVQTIYPNGS--PVQVYCDTTSYGTYTVIQSRGATGENVNFNIT 249

  Fly   590 WADYAQGFGAPGGE--FWIGNEQLHHLTLDNCSRLQVQM--------QDIYDN--VWVAEYKRFY 642
            :..|....|.||.|  ||.|.:.::||:.....|||:.:        :.||.:  |..||| .:.
 Worm   250 YDKYTDIIGTPGKETNFWFGLDNMNHLSGAKPYRLQIDLCCGTLLVAKQIYHSFKVGTAEY-GYN 313

  Fly   643 ISSRADGYRLHIAEYSGNASDALNYQQGMQFSAID--------DDRDISQTHCAANYE----GGW 695
            :::.||...:.:| ||...:|.     |.:||..|        ||.|..|....:..:    |||
 Worm   314 LTATADISGIGLA-YSSTYTDL-----GAKFSTFDNFTGPLGKDDCDEFQYFDDSGVQSQPYGGW 372

  Fly   696 WFSHCQHANLNG 707
            |:..|.: ||||
 Worm   373 WYGSCGN-NLNG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 61/200 (31%)
Y43C5A.2NP_501883.1 FReD 196..438 CDD:238040 60/198 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.