DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fcnb

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:XP_006497739.1 Gene:Fcnb / 14134 MGIID:1341158 Length:322 Species:Mus musculus


Alignment Length:156 Identity:53/156 - (33%)
Similarity:74/156 - (47%) Gaps:17/156 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PHDCSEVHTQ----TDGLHLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRSWADYAQ 595
            |..|.|:.||    |....:..|  ...||...|..|    |||..|||.|||.||.|.|..|.:
Mouse   103 PRTCKELLTQGHFLTGWYTIYLP--DCRPLTVLCDMDTDGGGWTVFQRRLDGSVDFFRDWTSYKR 165

  Fly   596 GFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGN 660
            |||:..||||:||:.:|.||....|.|:|.:.|.......|:|..|.|...|:.|:|.:..:.|.
Mouse   166 GFGSQLGEFWLGNDNIHALTTQGTSELRVDLSDFEGKHDFAKYSSFQIQGEAEKYKLILGNFLGG 230

  Fly   661 ASDALNYQQGMQFSAIDDDRDISQTH 686
            .:       |..|.::...:::|.|:
Mouse   231 GA-------GPAFPSVTISQNLSVTN 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 53/156 (34%)
FcnbXP_006497739.1 Collagen 40..95 CDD:189968
FReD 103..>238 CDD:238040 51/143 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.