DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Fcna

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_032021.1 Gene:Fcna / 14133 MGIID:1340905 Length:334 Species:Mus musculus


Alignment Length:189 Identity:70/189 - (37%)
Similarity:98/189 - (51%) Gaps:9/189 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 EAIINKLPHDCSEVHTQ---TDGLHLIAPAGQRHPLMTHCTAD----GWTTVQRRFDGSADFNRS 589
            :.:..:.|..|.::.|:   ..|.:.|.....| ||...|..|    |||..|||.|||.||.|.
Mouse   116 DTLCQRGPRSCKDLLTRGIFLTGWYTIHLPDCR-PLTVLCDMDVDGGGWTVFQRRVDGSIDFFRD 179

  Fly   590 WADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHI 654
            |..|.:|||..|.|||:||:.||.||.:....|:|.:||.......|:|..|.:|...:.|:|.:
Mouse   180 WDSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKYKLTL 244

  Fly   655 AEY-SGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRYNLG 712
            .:: .|.|.|:|.....|.|:..|.|.|.:..:|||.:.|.||:.:|..:||||||..|
Mouse   245 GQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRYLSG 303

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 70/183 (38%)