DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and Angptl7

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:XP_006239486.1 Gene:Angptl7 / 102552055 RGDID:7553363 Length:408 Species:Rattus norvegicus


Alignment Length:296 Identity:84/296 - (28%)
Similarity:130/296 - (43%) Gaps:70/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 LNKPHKR----------PHHQNVQAQM------------PQDDSPIDSVL--------AETLVSE 523
            |.|||||          ...:.::||:            .|:...:..|:        ::.:.|.
  Rat    92 LQKPHKRKTQLKAAGCCEEMRELKAQVANLSSLLGELSRKQESDWVSVVMQVMELESSSKRMESR 156

  Fly   524 LENVETQYEAIINKLP------------------HDCSEVHTQT---DGLHLIAP---AGQRHPL 564
            |...|::|..:.|::.                  :|||.::.:.   .|::.:.|   .|... |
  Rat   157 LTTAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDEFLGSPE-L 220

  Fly   565 MTHC----TADGWTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQ 625
            ...|    :..|||.:|||..|...|.:.|..|.||||:..|:||:|||.:|.||... :||:|:
  Rat   221 EVFCDMETSGGGWTIIQRRKSGLVSFYQDWKQYKQGFGSIRGDFWLGNEHIHRLTRQP-TRLRVE 284

  Fly   626 MQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGN-ASDALNYQQGMQFSAIDDDRDISQTHCAA 689
            ::|...|...|||..|.:.:..:.|||.:..|||| ..|||.|.....||..|.|.|.....||.
  Rat   285 LEDWEGNARYAEYSYFALGNELNSYRLFLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLDKCAQ 349

  Fly   690 NYEGGWWFSHCQHANLNGRYNL---------GLTWF 716
            ..:||:|::.|..:||||.|..         |::|:
  Rat   350 LRKGGYWYNCCTDSNLNGVYYRLGEHRKHMDGISWY 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 69/217 (32%)
Angptl7XP_006239486.1 FReD 191..403 CDD:238040 69/197 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.