DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and XB5913531

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:XP_012826224.3 Gene:XB5913531 / 100488177 XenbaseID:XB-GENE-5913532 Length:255 Species:Xenopus tropicalis


Alignment Length:250 Identity:80/250 - (32%)
Similarity:137/250 - (54%) Gaps:37/250 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   516 LAETLVSELENVETQYEAIINKLPH-DCSEVHT---QTDGLHLIAPAGQRHPLMTHC--TADG-- 572
            |...::|:.|:::|   .:::|:|. ||.::..   ::||.:||.|.|.:|||..:|  |.:|  
 Frog    14 LISPIISQSESLDT---LVLHKIPPLDCQDLWDKGFRSDGEYLIYPQGPQHPLPVYCDMTTNGMP 75

  Fly   573 WTTVQRRFDGSADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAE 637
            ||..|:|||||.|||::|.||..|||....|:|:|.:.:..||:.....|:|::::.......|.
 Frog    76 WTVFQKRFDGSTDFNQNWQDYVMGFGNADYEYWLGLQNIQRLTMTGRYELRVELENFNGQKVYAF 140

  Fly   638 YKRFYISSRA-----DGYRLHIAEYS-GNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWW 696
            |..|.:|.:|     |||:|::..:: |.|.|:|:...|.:||..|:|:.....:||..:.||:|
 Frog   141 YSNFSLSPQALNAEHDGYKLYVDGFTDGGAGDSLSVHVGQRFSTYDNDQINDIQNCAEYWGGGFW 205

  Fly   697 F--SHCQHANLNGRY---------NLGLTWFDAARNEWI----AVKSSRMLVKRL 736
            :  :.|..|.||.||         ..|.:|.     .|:    .:::|:|:::||
 Frog   206 YYSNGCADAGLNARYINPNTLKSPQHGFSWV-----TWVEYPETLRASQMMMRRL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 73/226 (32%)
XB5913531XP_012826224.3 FReD 33..255 CDD:238040 73/226 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232713at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.