DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and LOC100334800

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001315009.1 Gene:LOC100334800 / 100334800 -ID:- Length:246 Species:Danio rerio


Alignment Length:228 Identity:71/228 - (31%)
Similarity:110/228 - (48%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PHDCSEVHTQTDGLHLIAPAGQR-----------HPLMTHC---------TADGWTTVQRRFDGS 583
            |.|||::|.          :|:|           .|:...|         ...|||.:|:|.|||
Zfish    28 PCDCSDLHR----------SGERSSRTHTVYIDDSPINVDCHMISEGREDEHGGWTVIQKRMDGS 82

  Fly   584 ADFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRAD 648
            .:|.|.|.:|.:|||.|.||.|:|.|.:|.:|.:....|:|.::|.......|.|..|.:....|
Zfish    83 LNFYRPWKEYKRGFGTPEGEHWLGLENIHRITRNKKYMLRVDIEDFGGRKGCAHYSSFSVDCEED 147

  Fly   649 GYRLHIAEY-SGNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNG----- 707
            ||:||::.: .|.|.|:|:.....:||..|.|:|..:.:||..:.||:|:..|.|||.||     
Zfish   148 GYKLHVSGFRDGGAGDSLSSHNNQKFSTFDKDQDDYKKNCAREFLGGFWYKKCHHANPNGVYLWG 212

  Fly   708 ----RYNLGLTWFDAARNEWIAVKSSRMLVKRL 736
                .|.:|:.|:....|.:.::|...|.:||:
Zfish   213 HDRTHYAIGVCWWSWDHNYYNSLKYISMKIKRI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 70/226 (31%)
LOC100334800NP_001315009.1 FReD 28..245 CDD:238040 70/226 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D232713at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.