DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and mfap4.2

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001103320.1 Gene:mfap4.2 / 100126122 ZFINID:ZDB-GENE-071004-112 Length:242 Species:Danio rerio


Alignment Length:222 Identity:71/222 - (31%)
Similarity:120/222 - (54%) Gaps:23/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   538 LPHDCSEVHTQTD---GLHLIAPAGQRHPLMTHCTA---------DGWTTVQRRFDGSADFNRSW 590
            :|.|||:::...:   |::.|.|||:. |:..:|..         .|||.:|||.|||.:|.|..
Zfish    22 MPFDCSDIYKSGETLSGVYTIYPAGET-PVWVYCQMISDGKDEENGGWTVIQRRMDGSVNFYRPG 85

  Fly   591 ADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIA 655
            .||.:|||...||:|:|.|.|:.||......|:|.::|.......|:|..|.:....:||:|.::
Zfish    86 RDYKRGFGNVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVS 150

  Fly   656 EYS-GNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRY---------N 710
            .:: |.|.|:.:...||:||..|.|:|..:.:||..:.|.:|:|.|.:||.||.|         .
Zfish   151 GFTDGGAGDSASTHNGMKFSTFDKDQDTYEKNCAKEFLGAFWYSACHNANPNGVYLWHEGSTHNA 215

  Fly   711 LGLTWFDAARNEWIAVKSSRMLVKRLP 737
            :|::|:....|..:::|:..:.:|::|
Zfish   216 IGVSWYSWKGNNAVSMKTISIKIKQVP 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 70/219 (32%)
mfap4.2NP_001103320.1 FReD 23..239 CDD:238040 69/216 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.