DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and LOC100007488

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:NP_001315007.1 Gene:LOC100007488 / 100007488 -ID:- Length:245 Species:Danio rerio


Alignment Length:220 Identity:72/220 - (32%)
Similarity:113/220 - (51%) Gaps:24/220 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   539 PHDCSEVH---TQTDGLHLIAPAGQRHPLMTHC---------TADGWTTVQRRFDGSADFNRSWA 591
            |.|||:::   ....|::.|.|||. .|:..:|         ...|||.:|||.|||.:|.|.|.
Zfish    27 PFDCSDIYKSGQNLSGIYSIYPAGD-FPVWVYCQMVSEGKDEDKGGWTVIQRRMDGSVNFYRPWR 90

  Fly   592 DYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAE 656
            ||.:|||...||:|:|.|.|:.||......|:|.::|.......|:|..|.:....:||:|.::.
Zfish    91 DYKRGFGKVEGEYWLGLENLYQLTRHKKFMLRVDLEDFEGRRGFAQYSSFSVGCECEGYKLQVSG 155

  Fly   657 YS-GNASDALNYQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNG---------RYNL 711
            :: |.|.|.|:....::||..|.|:|..:..||..|.||:|:..|.:.|.||         .|.:
Zfish   156 FTDGGAGDCLSGHNDLKFSTFDKDQDTHEKSCAKEYLGGFWYGSCHNTNPNGVYLWGEDPTHYAI 220

  Fly   712 GLTWFDAARNEWIAVKSSRMLVKRL 736
            |:.| ...:|..:::|:..|.:||:
Zfish   221 GVCW-STWKNYAVSMKTFSMKIKRV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 71/218 (33%)
LOC100007488NP_001315007.1 FReD 25..244 CDD:238040 71/218 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.