DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sca and fgl1

DIOPT Version :9

Sequence 1:NP_476710.2 Gene:sca / 36411 FlyBaseID:FBgn0003326 Length:799 Species:Drosophila melanogaster
Sequence 2:XP_001923586.2 Gene:fgl1 / 100003029 ZFINID:ZDB-GENE-130815-1 Length:307 Species:Danio rerio


Alignment Length:278 Identity:87/278 - (31%)
Similarity:128/278 - (46%) Gaps:62/278 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 ETLVSELENVE---TQYEAIINKLPH-----------------------DCSEVH---TQTDGLH 553
            |.|..||.::|   |:.:.:|::|.:                       ||:::.   :.:.|.:
Zfish    28 ERLRVELRSLELRHTKQQQLIHRLMNINQMDDRSLKEGSFYDTGDTQYMDCAQIFKNGSTSSGFY 92

  Fly   554 LIAPAGQRHPLMTHCTAD-----GWTTVQRRFDGSADFNRSWADYAQGFG---APGGEFWIGNEQ 610
            :|.|.  |.|.......|     |||..|||.|||..|:|.|.||..|||   :..||||:||:.
Zfish    93 MIKPL--RSPTRVRVFCDMTEGGGWTLFQRRSDGSLSFDRDWNDYKIGFGDMKSANGEFWLGNDN 155

  Fly   611 LHHLTLDNCSRLQVQMQDIYDNVWVAEYKRFYISSRADGYRLHIAEYSGNASDALN--------- 666
            ||:||......|::.::|.......|.|:.|.:.:....|:|....|||.|.|||:         
Zfish   156 LHYLTSQGDYTLRINLEDFEGTHRFAVYRNFKVDNEEKHYQLQFGMYSGTAGDALSGSFHPEVQW 220

  Fly   667 --YQQGMQFSAIDDDRDISQTHCAANYEGGWWFSHCQHANLNGRYNL---------GLTWFDAAR 720
              ..|||:||..|.|.|....:||...:|||||:.|..|||||.|:.         |:.|: ...
Zfish   221 WASHQGMKFSTRDRDHDRYDRNCAQEDKGGWWFNRCHSANLNGFYHRGAYSASTDDGIVWY-PWH 284

  Fly   721 NEWIAVKSSRMLVKRLPA 738
            ..|.::||.:|.::  ||
Zfish   285 GWWYSLKSVQMKIR--PA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scaNP_476710.2 PRK13923 <200..300 CDD:276343
FBG 538..736 CDD:214548 78/251 (31%)
fgl1XP_001923586.2 FReD 74..299 CDD:238040 77/229 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.