DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and AGBL4

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:326 Identity:67/326 - (20%)
Similarity:111/326 - (34%) Gaps:116/326 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TY----HTLDTIYDWIDQECAAHDFLECKVIGQSYEGRDIKSIRLSK----RSG--NKAIFLEGN 171
            ||    |.||::      :....|:...:.:|||.:.|.:..:.::.    |.|  .|.:|:.|.
Human   182 TYTRFQHYLDSL------QKRNMDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGR 240

  Fly   172 IH-----------------------------AMEWISSATVTFLLNQLINSEDPEMQRLSEEYDW 207
            :|                             .:.|:|...:.||:     |:.|....|.|...:
Human   241 VHPGETPSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPGIIDFLV-----SQHPIACVLREYLVF 300

  Fly   208 IVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDC--YGIDMNRNFDYHW-GGAGWNIDEPCD 269
            .:.||:|||| ||.             ..||     |  .|.|:||    || ..:.|  ..|..
Human   301 KIAPMLNPDG-VYL-------------GNYR-----CSLMGFDLNR----HWLDPSPW--VHPTL 340

  Fly   270 HWFGG---------EEPNTEVE----IISLQNFVSSFEDGYIRSYMAYHAYGQYVLLP------- 314
            |   |         .:|.|.:|    |.:....::.|..|.|  :.....:.:..:.|       
Human   341 H---GVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNI--FEDEERFQRQAIFPKLLCQNA 400

  Fly   315 --YGHSNTEFPPNYEQMKR-IAAAFSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAYGVKKIPF 376
              :.:|:|.|  |.:.:|. ....|.....|.....:|...| ..:|::||.       ...:|:
Human   401 EDFSYSSTSF--NRDAVKAGTGRRFLGGLLDHTSYCYTLEVS-FYSYIISGT-------TAAVPY 455

  Fly   377 T 377
            |
Human   456 T 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 66/325 (20%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 64/318 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.