DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and AT5G42320

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001332683.1 Gene:AT5G42320 / 834237 AraportID:AT5G42320 Length:430 Species:Arabidopsis thaliana


Alignment Length:330 Identity:83/330 - (25%)
Similarity:135/330 - (40%) Gaps:68/330 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LIDESSVGDDS---QMEWETYHTLDTIYDWIDQECAAH-DFLECKVI-----GQSYEGRDIKSIR 156
            ::.|::..|.|   .:.|:.||:.|.:.:.|......| |.|..::|     |.:.|...:...|
plant    25 VLGETNPSDSSFVTPINWDLYHSSDDLMEQIHSLVHRHPDKLSIELIKSGNKGYNAEVNVVTYCR 89

  Fly   157 LSKRSGNKA---IFLEGNIHAMEWISSATVTFLLNQLINSEDPEMQR-----LSEEYDWIVVPMV 213
            ..|.|.:::   |.|....|..|.|:|.....:|:  |.||:..:..     |....|.:|:.||
plant    90 GGKESDDRSNFRILLTFGQHGRELITSELAFRILS--ILSEEQFLPNKNGGILKNTLDKLVIKMV 152

  Fly   214 ---NPDGFVYTHEVERLWRKNRRPNGYRNESGD-C-----YGIDMNRNFDYHWGGAGWNIDEPCD 269
               ||:|           ||       |.|||| |     .|:|:|||:...||....:.|...:
plant   153 PIENPNG-----------RK-------RVESGDLCERRNGRGVDLNRNWGVDWGKKEKDYDPSEE 199

  Fly   270 HWFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYVLLPYGHSN--TEFPPNYEQMKRI 332
            :  .|..|.:|.|...::....|| |.:|  ::..|:..:.:.:||.|.|  .|..|: ::|:.:
plant   200 N--PGTAPFSEPETQIMRKLAISF-DPHI--WINVHSGMEALFMPYDHKNITPEGLPS-QKMRTL 258

  Fly   333 AAAFSDAAAD---VYGSTFTYGASGLLNYVVSGAAKDWAYGVKKIPFTCTVEL------RDKGTF 388
            ....:.....   :.||     ..|.:.|:..|.|.|:.|.|.|.|...|.|:      ..:..|
plant   259 LEKLNKFHCHDRCMIGS-----GGGSVGYLAHGTATDYIYDVVKAPMAFTFEIYGDNQTASRDCF 318

  Fly   389 GFFLP 393
            ..|.|
plant   319 KMFNP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 0/2 (0%)
M14_CP_A-B_like 118..415 CDD:199844 79/310 (25%)
AT5G42320NP_001332683.1 M14-CPA-like 100..321 CDD:349446 64/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524270at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.