DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and AGBL2

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:287 Identity:59/287 - (20%)
Similarity:104/287 - (36%) Gaps:99/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 AARYDHFRIYQLTIETNL-----------QMEELKK--IHEHISVHFL--NELGAVGNKYNVIVG 73
            |.|.|.:. |:||:.|:|           :::..:|  .:....|:.|  ..|..||.|      
Human   280 AVRVDTYE-YELTLRTDLYTNKHTQWFYFRVQNTRKDATYRFTIVNLLKPKSLYTVGMK------ 337

  Fly    74 PLFHRALEKTLKFL-------EIVYEVIVDDLQKLIDESSVGDDSQ----MEW--ETYHTLDTI- 124
            ||.:..|:...:.:       ||.|.           :::..|..|    :.|  :..:..||. 
Human   338 PLLYSQLDANTRNIGWRREGNEIKYY-----------KNNTDDGQQPFYCLTWTIQFPYDQDTCF 391

  Fly   125 ------YDWIDQEC---------AAHDFLECKVIGQSYEGRDIKSIRLSKRS-------GNKAIF 167
                  |.:.|.:|         ....|.:.:.:.:|..|..:..:.::..|       ..||:.
Human   392 FAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAAKKAVV 456

  Fly   168 LEGNIHAME----WISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLW 228
            |...:|..|    |:....:.|:|     |..|:.|.|.:.:.:.|:||:||||.:.        
Human   457 LSARVHPGESNGSWVMKGFLDFIL-----SNSPDAQLLRDIFVFKVLPMLNPDGVIV-------- 508

  Fly   229 RKNRRPNGYRNESGDC--YGIDMNRNF 253
                  ..||     |  .|.|:||::
Human   509 ------GNYR-----CSLAGRDLNRHY 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 17/91 (19%)
M14_CP_A-B_like 118..415 CDD:199844 35/165 (21%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 30/142 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.