DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and Agbl3

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001276585.1 Gene:Agbl3 / 76223 MGIID:1923473 Length:1006 Species:Mus musculus


Alignment Length:279 Identity:63/279 - (22%)
Similarity:106/279 - (37%) Gaps:94/279 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DHFRIYQLTIE----------------TNLQMEELKKIHEHISVHFLNELGAVGNKYNVIVGPLF 76
            ||  .|:||:.                ||.|.|   .::....|:|...    .:.||..:.|||
Mouse   193 DH--EYELTVRPDLFTNKHTQWYYFQVTNTQAE---IVYRFTIVNFTKP----ASLYNRGMKPLF 248

  Fly    77 HRALEKTLKFLEIVYEVIVDDLQKLIDESSVGDDSQ----MEWETY---HTLDTIY--------- 125
            :.  ||..|...|.::.|.|.::..  ::::|.|.:    :.| |:   |:.||.|         
Mouse   249 YS--EKEAKTHNIGWQRIGDQIKYY--KNNLGQDGRHFFSLTW-TFQFPHSQDTCYFAHCYPYTY 308

  Fly   126 -------DWIDQECAAHDFLECKVIGQSYEGRDIKSIRL--------SKRSGNKAIFLEGNIHAM 175
                   ..|:.:.....|.:.:|:..:.....:..:.:        |||   ||:.|...:|..
Mouse   309 SNLQEYLSGINSDPVRSKFCKIRVLCHTLARNMVYVLTITTPLKTSDSKR---KAVILTARVHPG 370

  Fly   176 E----WISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNG 236
            |    ||....:.::|.   :|.|..:  |.:.:.:.||||:||||.:.              ..
Mouse   371 ETNSSWIMKGFLDYILG---DSSDARL--LRDTFIFKVVPMLNPDGVIV--------------GN 416

  Fly   237 YRNESGDC--YGIDMNRNF 253
            ||     |  .|.|:|||:
Mouse   417 YR-----CSLAGRDLNRNY 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 19/85 (22%)
M14_CP_A-B_like 118..415 CDD:199844 37/169 (22%)
Agbl3NP_001276585.1 M14_AGBL2-3_like 315..576 CDD:133117 33/143 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.