DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and Cpa4

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_017177239.1 Gene:Cpa4 / 71791 MGIID:1919041 Length:469 Species:Mus musculus


Alignment Length:428 Identity:126/428 - (29%)
Similarity:216/428 - (50%) Gaps:56/428 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GRMAAR----------YDHFRIYQLTIETNLQMEELKKIHE-----HISVHFLNELGAVGNKYNV 70
            |.:|:|          :...:::::.:...   :|::|:.|     |:.:.............::
Mouse    54 GLLASRKLTIIFFSLPFSRDQVFRINVRNG---DEIRKLTELVNSDHLKLSVWKSPSTFDRPVDI 115

  Fly    71 IVGPLFHRALEKTLKFLEIVYEVIVDDLQKLIDESSVGDDSQME------------WETYHTLDT 123
            :|..:....::..||...:.|.|.::|||.|:|    .:|.:|:            :..||.|:.
Mouse   116 LVPSVSLLPVKSFLKSQGLDYSVTIEDLQALLD----NEDEEMQHNEGIERSGDFNYGAYHPLEA 176

  Fly   124 IYDWIDQECAAHDF--LECKV-IGQSYEGRDIKSIRLSKRSGNK--AIFLEGNIHAMEWISSATV 183
            ||..:|.  .|.||  |..:| ||:::|.|.:..::.|...|.|  ||:|...|||.||||.||.
Mouse   177 IYHEMDS--IATDFPELVSRVKIGETFEKRPMYVLKFSTGGGKKRPAIWLNAGIHAREWISQATA 239

  Fly   184 TFLLNQLIN--SEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYG 246
            .:...:::.  .:||.:..:.::.|..::|:.||||:|||....|||||.|.    ||....|.|
Mouse   240 IWTARKIVTDYKKDPAITSILKKVDIFLLPVANPDGYVYTQSQNRLWRKTRS----RNPGSRCVG 300

  Fly   247 IDMNRNFDYHWGGAGWNIDEPCDHWFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQYV 311
            .|.|||::..:.|.|.: |.||...:.|..||:|||:.|:.:|:.  :.|..:.::..|:|.|.:
Mouse   301 ADPNRNWNASFAGEGTS-DNPCSEVYHGSHPNSEVEVKSVVDFIQ--KHGNFKCFIDLHSYSQLL 362

  Fly   312 LLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAY--GVKKI 374
            :.|||:: .:..|:.|::..:|...:.|.|.:.|:.:..|.:....|..||::.||||  |:|  
Mouse   363 MYPYGYT-VKKAPDAEELDDVARNAAQALASLSGTKYRVGPTCTTVYPASGSSVDWAYDNGIK-- 424

  Fly   375 PFTCTVELRDKGTFGFFLPSNQITEVGLEVTAGLKALV 412
             :..|.||||.|.:||.||::||.....|...|||.::
Mouse   425 -YAFTFELRDTGYYGFLLPASQIIPTAEETWLGLKTIM 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 13/74 (18%)
M14_CP_A-B_like 118..415 CDD:199844 107/304 (35%)
Cpa4XP_017177239.1 Propep_M14 81..150 CDD:366995 14/75 (19%)
M14_CPA 166..467 CDD:349442 107/309 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848038
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.