DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and Cpo

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_038940238.1 Gene:Cpo / 689717 RGDID:1588771 Length:325 Species:Rattus norvegicus


Alignment Length:343 Identity:85/343 - (24%)
Similarity:130/343 - (37%) Gaps:105/343 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 WETYHTLDT-IYDWIDQ------ECAAHDFLECKVIGQSYEG------RDIKSIRLSKRSGNKAI 166
            ::.||.... ||.|:.|      |.....||.     .:||.      ::...|.|:..:..|.|
  Rat    22 YDRYHPWGRGIYQWMRQVSEKYAEVLTQHFLR-----MTYETWPMHYLKESAEISLTSSNSKKTI 81

  Fly   167 FLEGNIHAMEWISSA------------TVTFLLNQLI---------------------------- 191
            :::..|||..||:.|            |...:||..|                            
  Rat    82 WIDCGIHASRWIAPAFCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYFFPVNWNGIQLAPLQI 146

  Fly   192 --NSED-PEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNF 253
              |.:| ..:.||.:|.|: |   :|.|| :||      |..                       
  Rat   147 LQNDKDSARIGRLLKELDFXV---LNADGXIYT------WTT----------------------- 179

  Fly   254 DYHWG---GAGW---NIDEP--C-DHWFGGEEPNTEVEIISLQNFVSSFEDGYIRSYMAYHAYGQ 309
              .|.   |.|:   :|..|  | |..|.|.||..|.|:...|....:.....|..::...:|||
  Rat   180 --AWTLPVGQGYLCLHIGTPINCQDVTFCGIEPMLEPELTPSQALQKARGKKDILCFLIMGSYGQ 242

  Fly   310 YVLLPYGHSNTEFPPNYEQMKRIAAAFSDAAADVYGSTFTYGASGLLNYVVSGAAKDWAYGVKKI 374
            .:|.||||:..: |.|||::.::....:.|....:|:.:..|:...:.|::||::|||..|:...
  Rat   243 LILTPYGHTKNK-PHNYEELIQVGQKAARALKAKHGTNYRVGSGADILYMLSGSSKDWNGGIGIP 306

  Fly   375 PFTCTVELRDKGTFGFFL 392
            .|:.|.||.|.||.||.|
  Rat   307 LFSYTFELVDNGTHGFAL 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416
M14_CP_A-B_like 118..415 CDD:199844 85/340 (25%)
CpoXP_038940238.1 Peptidase_M14_like 22..324 CDD:416253 84/341 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.