DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and AGBL5

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_068603.4 Gene:AGBL5 / 60509 HGNCID:26147 Length:886 Species:Homo sapiens


Alignment Length:437 Identity:87/437 - (19%)
Similarity:134/437 - (30%) Gaps:168/437 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 HRALE--KTLKFLEIVYEVIVDDLQKLIDESSVGDDSQMEWETYHT--LDTIYDWIDQECAAHDF 137
            ||.:|  ....|....|.....|.|:|:::.   |....|....|:  |||||...:..|.:.|.
Human   141 HRFVEGRGATTFFAFCYPFSYSDCQELLNQL---DQRFPENHPTHSSPLDTIYYHRELLCYSLDG 202

  Fly   138 L--------ECKVIGQSYEGR------DIKSIRLSKRSGNKAIFLEGNIHAMEWISSATVTFLLN 188
            |        .|..:.:..|.|      |..:.|..:.:|.:..||...:|..|..||......|:
Human   203 LRVDLLTITSCHGLREDREPRLEQLFPDTSTPRPFRFAGKRIFFLSSRVHPGETPSSFVFNGFLD 267

  Fly   189 QLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLWRKNRRPNGYRNESGDCYGIDMNRNF 253
            .::..:||..|.|...:.:.::||:||||.|..|              ||.:|   .|:::||.:
Human   268 FILRPDDPRAQTLRRLFVFKLIPMLNPDGVVRGH--------------YRTDS---RGVNLNRQY 315

  Fly   254 ----------------------------------------------------------------- 253
                                                                             
Human   316 LKPDAVLHPAIYGAKAVLLYHHVHSRLNSQSSSEHQPSSCLPPDAPVSDLEKANNLQNEAQCGHS 380

  Fly   254 -DYHWGGAGWNIDEPCDH-----WF------GGEE--PNTEVEIISLQNFVSSFEDGYIRSYMAY 304
             |.| ....|...||.:.     |.      |.||  |:|          :...|.| :..|:..
Human   381 ADRH-NAEAWKQTEPAEQKLNSVWIMPQQSAGLEESAPDT----------IPPKESG-VAYYVDL 433

  Fly   305 HAY----GQYVLLPYGHSNTEFPPNYEQM---KRIAAAFSDAAADVYGSTFT------------- 349
            |.:    |.::   ||:|.::.....|.|   |.|  :.:.|..|..|..|:             
Human   434 HGHASKRGCFM---YGNSFSDESTQVENMLYPKLI--SLNSAHFDFQGCNFSEKNMYARDRRDGQ 493

  Fly   350 ----------YGASGLLNYVVSGAAKDWAYGVKKIPFTCTVELRDKG 386
                      |.|||:::........:....|..||..|    .|.|
Human   494 SKEGSGRVAIYKASGIIHSYTLECNYNTGRSVNSIPAAC----HDNG 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 8/28 (29%)
M14_CP_A-B_like 118..415 CDD:199844 77/394 (20%)
AGBL5NP_068603.4 M14_AGBL5_like 176..568 CDD:199860 78/399 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..364 0/19 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 605..734
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 784..848
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.