DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12374 and agbl2

DIOPT Version :9

Sequence 1:NP_610819.1 Gene:CG12374 / 36410 FlyBaseID:FBgn0033774 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:287 Identity:57/287 - (19%)
Similarity:102/287 - (35%) Gaps:106/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RYDHFRIYQLTIETNLQMEE--------LKKIHEHISVHF-LNELGAVGNKYNVIVGPLFHRALE 81
            :||    |:||:.|:|...:        ::.:.|.::..| :..|....:.|...:.||.:.  |
Zfish   223 QYD----YELTLRTDLYTTKHTQWFYFRVRNMREGVTYRFTIINLMKSSSLYGAGMCPLLYS--E 281

  Fly    82 KT--------------LKFLEIVYEVIVDDLQKLIDESSVGDDSQMEWETYHTLDTIYDWIDQEC 132
            ||              :::.                .:::..|.:..:....||:..||. |...
Zfish   282 KTAWLKGEGWKRTGSSIRYY----------------RNNIEQDGKALYSLTWTLEFPYDG-DTCY 329

  Fly   133 AAH-----------------------DFLECKVIGQSYEGRDI-------KSIRLSKRSGNKAIF 167
            .||                       .:.:.:|:.:|..|..:       .|..|::|...:|:.
Zfish   330 LAHCYPYTYSKLQHYLREVISDPVRAAYCKLRVLCRSLAGNAVYVLTITAPSSSLAERKAKRAVV 394

  Fly   168 LEGNIHAME----WISSATVTFLLNQLINSEDPEMQRLSEEYDWIVVPMVNPDGFVYTHEVERLW 228
            :...:|..|    |:....:.|||:.|     |:...|.|.:.:.|:||:||||.|.        
Zfish   395 VTARVHPGETNGSWMMQGFLEFLLSDL-----PDAHLLRETFIFKVIPMLNPDGVVV-------- 446

  Fly   229 RKNRRPNGYRNESGDC--YGIDMNRNF 253
                  ..||     |  .|.|:|||:
Zfish   447 ------GNYR-----CSLAGRDLNRNY 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12374NP_610819.1 Propep_M14 34..104 CDD:280416 13/92 (14%)
M14_CP_A-B_like 118..415 CDD:199844 40/172 (23%)
agbl2XP_017209580.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.